(data stored in ACNUC7421 zone)

EMBL: CP002116.PE54

CP002116.PE54        Location/Qualifiers
FT   CDS             58172..59704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0054"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro
FT                   IPR003593:IPR003439:IPR015861:IPR017871; KEGG: ava:Ava_2172
FT                   ABC transporter-like; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Ribose import ATP-binding protein RbsA;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79214"
FT                   /db_xref="GOA:E1R6T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T2"
FT                   /protein_id="ADK79214.1"
FT                   /translation="MDEQDRKEPILSVRNLSKRFPGVQALDGVSLDIYAGEVHVLMGEN
FT                   GAGKSTLMKILAGVYKADEGEIRIDGQLVAPENPLQAMALGVNLINQELGVATNLTVAE
FT                   NVFMGSEPHRFGVIDRHQMAIRTQEVLKKLGASFQPEVRASLLKVAEQQQVDIARALVH
FT                   NGRVLIMDEPTAALSEREIDRLFDLVRSLREQGLAIVYISHRLAEVSVIADRVSVLRDG
FT                   QYIGTVTKDNMDNETIVKMMVGRSLKDFYEHQTAEKKEDNYLVVKHVSDGKRVKDVSFQ
FT                   AAAGEILALSGLVGSGRTELARLIFGADKPLTGEVIVEGRKLTITSPKDAIHQGIGYVP
FT                   EDRKTEGLFLGMSSQENIVMNIMEQKARFGILNRKENGSITDHAIKQLNIKLSNPRNAA
FT                   LSLSGGNQQKLLLARWLQIKPRVLILDEPTRGVDVGAKSEIYKLIGEIAQNGVAVVFIS
FT                   SELPEVVGLAQRVLVMREGRITAELRGPEQINQEIIMAYATGIRKPDYTFSA"
     MDEQDRKEPI LSVRNLSKRF PGVQALDGVS LDIYAGEVHV LMGENGAGKS TLMKILAGVY        60
     KADEGEIRID GQLVAPENPL QAMALGVNLI NQELGVATNL TVAENVFMGS EPHRFGVIDR       120
     HQMAIRTQEV LKKLGASFQP EVRASLLKVA EQQQVDIARA LVHNGRVLIM DEPTAALSER       180
     EIDRLFDLVR SLREQGLAIV YISHRLAEVS VIADRVSVLR DGQYIGTVTK DNMDNETIVK       240
     MMVGRSLKDF YEHQTAEKKE DNYLVVKHVS DGKRVKDVSF QAAAGEILAL SGLVGSGRTE       300
     LARLIFGADK PLTGEVIVEG RKLTITSPKD AIHQGIGYVP EDRKTEGLFL GMSSQENIVM       360
     NIMEQKARFG ILNRKENGSI TDHAIKQLNI KLSNPRNAAL SLSGGNQQKL LLARWLQIKP       420
     RVLILDEPTR GVDVGAKSEI YKLIGEIAQN GVAVVFISSE LPEVVGLAQR VLVMREGRIT       480
     AELRGPEQIN QEIIMAYATG IRKPDYTFSA                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page