(data stored in ACNUC7421 zone)

EMBL: CP002116.PE55

CP002116.PE55        Location/Qualifiers
FT   CDS             59728..60696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0055"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4158 ABC-type sugar transport system
FT                   permease component; InterPro IPR001851; KEGG:
FT                   npu:Npun_R5324 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79215"
FT                   /db_xref="GOA:E1R6T3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T3"
FT                   /protein_id="ADK79215.1"
FT                   /translation="MSSNNLATKLKQQNSAIWESLGILPILLVIVILFSLLSGNFLRPT
FT                   NLMNILRQASINIVLAAGMTLVILTGGIDLSVGSILASTAVVSLLVSLNPSLQAFTVIA
FT                   PLLTGLLFGVLNGILIAYVKLPFFIVVLGSMTALRGASYLLANGTTLINNDLNFAWIGN
FT                   AYLGPFPWLAIIALAVIAIMWFILRKTVLGVHIYAVGGNPTAARLTGINVSFVLVFVYA
FT                   MSGLLSGLGGIMTASRLYSASGLLGNGYELDAIASVILGGTSISGGSGSVVGTLVGALI
FT                   IAVLNNGLTLMNVSYFWQLVVRGIVIIVAVLIERFRHRKKV"
     MSSNNLATKL KQQNSAIWES LGILPILLVI VILFSLLSGN FLRPTNLMNI LRQASINIVL        60
     AAGMTLVILT GGIDLSVGSI LASTAVVSLL VSLNPSLQAF TVIAPLLTGL LFGVLNGILI       120
     AYVKLPFFIV VLGSMTALRG ASYLLANGTT LINNDLNFAW IGNAYLGPFP WLAIIALAVI       180
     AIMWFILRKT VLGVHIYAVG GNPTAARLTG INVSFVLVFV YAMSGLLSGL GGIMTASRLY       240
     SASGLLGNGY ELDAIASVIL GGTSISGGSG SVVGTLVGAL IIAVLNNGLT LMNVSYFWQL       300
     VVRGIVIIVA VLIERFRHRK KV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page