(data stored in ACNUC7421 zone)

EMBL: CP002116.PE56

CP002116.PE56        Location/Qualifiers
FT   CDS             60711..62132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0056"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: rxy:Rxyl_2898
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like; SPTR:
FT                   Xylulokinase; PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79216"
FT                   /db_xref="GOA:E1R6T4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T4"
FT                   /protein_id="ADK79216.1"
FT                   /translation="MYLGIDLGTGSVKLMLLGPDGAEHTVSRSYEVSSPHSGWAQIDTD
FT                   IWLAALSSCIRELPGVEGVKAIGLSGQMHGIVPCSGMSGTAPVALGSAITWADQRAAET
FT                   LPYYKTFSEQTLSKLGNPPSAGMAGPILLWLRDQMPGLFAKIDIACMPKDFIRATLTGD
FT                   RLTDYSDASGTLLYDFSIQGWHAELVRAIGLDMTQLPQIRAGNSIAGFVSDDAARRFGL
FT                   PPGIPVALGAGDTPAAFFGTDLHDPGTAQISIGTAAQIGVPMAERGIHTVMNLNLFEGV
FT                   RPGSRYRIAAMMNGGLALEWVRRQLGFSWQDLYRSLERRGLGTPSDLIFIPYLSGERTP
FT                   HMNPDARGAWIGLSLHHQREDLALAALLGVASTIRLGLDTLLSAGNSSISQLRLVGGSA
FT                   RFPFWRKVLAAMLERDLLVSQQTDSSARGAALMAAEAIGERLSPSFGFDCEHAESYSWM
FT                   KEYFQKQQDLYYKIF"
     MYLGIDLGTG SVKLMLLGPD GAEHTVSRSY EVSSPHSGWA QIDTDIWLAA LSSCIRELPG        60
     VEGVKAIGLS GQMHGIVPCS GMSGTAPVAL GSAITWADQR AAETLPYYKT FSEQTLSKLG       120
     NPPSAGMAGP ILLWLRDQMP GLFAKIDIAC MPKDFIRATL TGDRLTDYSD ASGTLLYDFS       180
     IQGWHAELVR AIGLDMTQLP QIRAGNSIAG FVSDDAARRF GLPPGIPVAL GAGDTPAAFF       240
     GTDLHDPGTA QISIGTAAQI GVPMAERGIH TVMNLNLFEG VRPGSRYRIA AMMNGGLALE       300
     WVRRQLGFSW QDLYRSLERR GLGTPSDLIF IPYLSGERTP HMNPDARGAW IGLSLHHQRE       360
     DLALAALLGV ASTIRLGLDT LLSAGNSSIS QLRLVGGSAR FPFWRKVLAA MLERDLLVSQ       420
     QTDSSARGAA LMAAEAIGER LSPSFGFDCE HAESYSWMKE YFQKQQDLYY KIF              473
//

If you have problems or comments...

PBIL Back to PBIL home page