(data stored in ACNUC7421 zone)

EMBL: CP002116.PE57

CP002116.PE57        Location/Qualifiers
FT   CDS             62189..63106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0057"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: lbf:LBF_2370
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Putative two-component response
FT                   regulator; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79217"
FT                   /db_xref="GOA:E1R6T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T5"
FT                   /protein_id="ADK79217.1"
FT                   /translation="MADNTVVILWFSIVFQLMAAAYALFLIRVTGLRYSWICISLALIL
FT                   MSVRRIVSLSSGLLGAATMGEPLYEAIGLLLSMLVFVGIVGIRSILVEWRKNQTKVEAL
FT                   LQEKEMILREVHHRIKNNMSTILSFLSLQAETLGSSPARTSIEEAENRVRSMMILYDKL
FT                   YRGENVDACPIDQYLPLLIDQILATFPNSDSVEVEKSIGNFELDAKRLSLVGIIVNELL
FT                   TNSMKYAFSDATRGHIRVHAELESGQVLIRFEDNGTGIPAHVDFEGTSDLGLRMIKALT
FT                   TQLDGTVQLEREEGTCISISFPFQ"
     MADNTVVILW FSIVFQLMAA AYALFLIRVT GLRYSWICIS LALILMSVRR IVSLSSGLLG        60
     AATMGEPLYE AIGLLLSMLV FVGIVGIRSI LVEWRKNQTK VEALLQEKEM ILREVHHRIK       120
     NNMSTILSFL SLQAETLGSS PARTSIEEAE NRVRSMMILY DKLYRGENVD ACPIDQYLPL       180
     LIDQILATFP NSDSVEVEKS IGNFELDAKR LSLVGIIVNE LLTNSMKYAF SDATRGHIRV       240
     HAELESGQVL IRFEDNGTGI PAHVDFEGTS DLGLRMIKAL TTQLDGTVQL EREEGTCISI       300
     SFPFQ                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page