(data stored in ACNUC7421 zone)

EMBL: CP002116.PE58

CP002116.PE58        Location/Qualifiers
FT   CDS             complement(63113..64912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0058"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR003660; KEGG: cbt:CLH_1795
FT                   methyl-accepting chemotaxis protein; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; SPTR:
FT                   Methyl-accepting chemotaxis protein; PFAM: HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79218"
FT                   /db_xref="GOA:E1R6T6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T6"
FT                   /protein_id="ADK79218.1"
FT                   /translation="MNSSIQSIKWKLLGSFLLLILMFASIEIITFRGNQMNSQKIHDLK
FT                   NELLPETLSFLTIEKDVIQIQQWLTDISATRAAPGYDDGFNEAESYYNDAQERVDTFIQ
FT                   VYASKEENTAVDTLRTFKQDLDAFYDTGKAMAEAYINGGPSKGNPMMGEFDPVAERLSR
FT                   TMRDLVDSHTAGLNQAVVAIEANNGFVNRLTLLLMAAIILISALVAFLSIRTIHVGLLQ
FT                   VMQYAQNLSIGSFTLETEFHRKDEFGQLIRHFNEGFATVRSLIVSVKESADASSAVNTT
FT                   LRTSTDEVSASVTEIRANTESIGHHIERQTGLVSESSSAVEQIRTNIQDMTNQVEQQAG
FT                   AVIQSSAAVEEMAASIANVARISQNRQQEIPELISVIEQTDSNIESTGMVIDNVAALST
FT                   QMLEVIGVINNISTQTNLLAMNAAIEAAHAGEAGKGFSVVADEIRKLAEETSSNSKQIA
FT                   ETLGKVNAIIQEAQESAQENKTSFARLRLGVTNLANSFQEVSSTMGEINTGADEINIAI
FT                   NELTEITESIKSASSEINNGAGEIAESMDGLQGVSSEILLGIREISAGVQEVTGSMVTL
FT                   QELFSESVEAVDRIEDNLKRFSI"
     MNSSIQSIKW KLLGSFLLLI LMFASIEIIT FRGNQMNSQK IHDLKNELLP ETLSFLTIEK        60
     DVIQIQQWLT DISATRAAPG YDDGFNEAES YYNDAQERVD TFIQVYASKE ENTAVDTLRT       120
     FKQDLDAFYD TGKAMAEAYI NGGPSKGNPM MGEFDPVAER LSRTMRDLVD SHTAGLNQAV       180
     VAIEANNGFV NRLTLLLMAA IILISALVAF LSIRTIHVGL LQVMQYAQNL SIGSFTLETE       240
     FHRKDEFGQL IRHFNEGFAT VRSLIVSVKE SADASSAVNT TLRTSTDEVS ASVTEIRANT       300
     ESIGHHIERQ TGLVSESSSA VEQIRTNIQD MTNQVEQQAG AVIQSSAAVE EMAASIANVA       360
     RISQNRQQEI PELISVIEQT DSNIESTGMV IDNVAALSTQ MLEVIGVINN ISTQTNLLAM       420
     NAAIEAAHAG EAGKGFSVVA DEIRKLAEET SSNSKQIAET LGKVNAIIQE AQESAQENKT       480
     SFARLRLGVT NLANSFQEVS STMGEINTGA DEINIAINEL TEITESIKSA SSEINNGAGE       540
     IAESMDGLQG VSSEILLGIR EISAGVQEVT GSMVTLQELF SESVEAVDRI EDNLKRFSI        599
//

If you have problems or comments...

PBIL Back to PBIL home page