(data stored in ACNUC7421 zone)

EMBL: CP002116.PE59

CP002116.PE59        Location/Qualifiers
FT   CDS             65000..66766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0059"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR001697:IPR015794:IPR018209; KEGG: pth:PTH_2214
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PRIAM: Pyruvate kinase; SPTR: Pyruvate
FT                   kinase; TIGRFAM: pyruvate kinase; PFAM: Pyruvate kinase,
FT                   barrel domain; Pyruvate kinase, alpha/beta domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79219"
FT                   /db_xref="GOA:E1R6T7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T7"
FT                   /protein_id="ADK79219.1"
FT                   /translation="MKYLRKTRIVATIGPACDDLAIQKELLKAGVNVARFNFSHGNHEE
FT                   QAKRIASMRRASEETSVPVALMMDTKGPEIRTGNVKGEAELALHSGFEIVLTSRHVEGT
FT                   REELSVSYQNLPSEVEAGDHIFIADGVIDLEVLAVSGPDIRCLIRNGGMLGSKKNVNVP
FT                   GVKVGLPAITEKDREDIRFAVEHQMDYIAASFIRRPEDVEEIREILKQYHSSIRIIAKI
FT                   ENQEGLDNIDDIIRISDGVMVARGDLGVQLSTEQIPLAQKRIIGKCMRQGKPVITATQM
FT                   LDSMIHNPSPTRAELTDVANAIFDGTDAVMLSGETAGGAFPVRSVETMGRIAEAVETSE
FT                   EYRRRCTQWFETVQRPKDIGHTIARAAYVVASDIDASAIVAPTLRGNTPRILSNYRPNQ
FT                   LIIAVTTSEESYRQLLLHWGIFPILSAPVKDSDMMIQNALRLAREHGYVAPPDRVVTTA
FT                   GIPLNSPQPLNTIKIHFLGTILNRGHAGMGDRCSGALVKAENFELAQHRLRWDGTEILL
FT                   TGSIGKELFPRLSSLRGIVIEGELSLSPEEVRKIASKIVIIADVPNAMDNFEDGQLVTL
FT                   DGKEKIIYEGFM"
     MKYLRKTRIV ATIGPACDDL AIQKELLKAG VNVARFNFSH GNHEEQAKRI ASMRRASEET        60
     SVPVALMMDT KGPEIRTGNV KGEAELALHS GFEIVLTSRH VEGTREELSV SYQNLPSEVE       120
     AGDHIFIADG VIDLEVLAVS GPDIRCLIRN GGMLGSKKNV NVPGVKVGLP AITEKDREDI       180
     RFAVEHQMDY IAASFIRRPE DVEEIREILK QYHSSIRIIA KIENQEGLDN IDDIIRISDG       240
     VMVARGDLGV QLSTEQIPLA QKRIIGKCMR QGKPVITATQ MLDSMIHNPS PTRAELTDVA       300
     NAIFDGTDAV MLSGETAGGA FPVRSVETMG RIAEAVETSE EYRRRCTQWF ETVQRPKDIG       360
     HTIARAAYVV ASDIDASAIV APTLRGNTPR ILSNYRPNQL IIAVTTSEES YRQLLLHWGI       420
     FPILSAPVKD SDMMIQNALR LAREHGYVAP PDRVVTTAGI PLNSPQPLNT IKIHFLGTIL       480
     NRGHAGMGDR CSGALVKAEN FELAQHRLRW DGTEILLTGS IGKELFPRLS SLRGIVIEGE       540
     LSLSPEEVRK IASKIVIIAD VPNAMDNFED GQLVTLDGKE KIIYEGFM                    588
//

If you have problems or comments...

PBIL Back to PBIL home page