(data stored in ACNUC7421 zone)

EMBL: CP002116.PE6

CP002116.PE6         Location/Qualifiers
FT   CDS             4517..4672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0006"
FT                   /product="ribosomal protein L34"
FT                   /note="InterPro IPR000271; KEGG: btu:BT0440 50S ribosomal
FT                   protein L34; PFAM: ribosomal protein L34; SPTR: 50S
FT                   ribosomal protein L34; TIGRFAM: ribosomal protein L34;
FT                   PFAM: Ribosomal protein L34; TIGRFAM: ribosomal protein
FT                   L34, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79166"
FT                   /db_xref="GOA:E1R6N4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N4"
FT                   /protein_id="ADK79166.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTRGGRLVLARRRKKGRKKLSVA
FT                   DEKKPY"
     MKRTYQPSRV KRNRKFGFRA RMKTRGGRLV LARRRKKGRK KLSVADEKKP Y                 51
//

If you have problems or comments...

PBIL Back to PBIL home page