(data stored in ACNUC7421 zone)

EMBL: CP002116.PE60

CP002116.PE60        Location/Qualifiers
FT   CDS             66913..67215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0060"
FT                   /product="protein of unknown function DUF59"
FT                   /note="COGs: COG2151 metal-sulfur cluster biosynthetic
FT                   protein; InterPro IPR002744:IPR002052; KEGG: sti:Sthe_0635
FT                   protein of unknown function DUF59; PFAM: protein of unknown
FT                   function DUF59; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79220"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T8"
FT                   /protein_id="ADK79220.1"
FT                   /translation="MINTETVLKALEDVVDPELGYSVVELGLIYRVKVEGKRVEIDFTL
FT                   TSFGCPLADLLTADIEAAVRSLHPAAEPVTTLVWDPPWGPERMNEEARLDLGYPV"
     MINTETVLKA LEDVVDPELG YSVVELGLIY RVKVEGKRVE IDFTLTSFGC PLADLLTADI        60
     EAAVRSLHPA AEPVTTLVWD PPWGPERMNE EARLDLGYPV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page