(data stored in ACNUC7421 zone)

EMBL: CP002116.PE61

CP002116.PE61        Location/Qualifiers
FT   CDS             67234..68040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0061"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro
FT                   IPR010230:IPR003593:IPR003439:IPR017871; KEGG:
FT                   gtn:GTNG_2946 ABC transporter ATP-binding protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter ATP-binding protein; TIGRFAM: FeS assembly
FT                   ATPase SufC; PFAM: ABC transporter; TIGRFAM: FeS assembly
FT                   ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79221"
FT                   /db_xref="GOA:E1R6T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T9"
FT                   /protein_id="ADK79221.1"
FT                   /translation="MSVLTIKGLRASIDGKPILNGVDLILKSGEVHALMGPNGSGKSTL
FT                   ANVIMGNPRYEVTGGTIDLDGTDILALPVHERARLGLFLAFQYPVEIPGLSMAKFLRRA
FT                   AETRLSQGQNLRVSSFLKGVRADMDRLSFDKAFLNRSLNDGFSGGEKKRAEILQLLTLK
FT                   PKLAIFDETDSGLDIDAIKSVAAGIDHMRGPDFGALIITHYRRILDYLAPEFVHVLFQG
FT                   RVVLSGGNEIVRELEERGYDWVKEGYGEAGGTPLVPETKASQAAHV"
     MSVLTIKGLR ASIDGKPILN GVDLILKSGE VHALMGPNGS GKSTLANVIM GNPRYEVTGG        60
     TIDLDGTDIL ALPVHERARL GLFLAFQYPV EIPGLSMAKF LRRAAETRLS QGQNLRVSSF       120
     LKGVRADMDR LSFDKAFLNR SLNDGFSGGE KKRAEILQLL TLKPKLAIFD ETDSGLDIDA       180
     IKSVAAGIDH MRGPDFGALI ITHYRRILDY LAPEFVHVLF QGRVVLSGGN EIVRELEERG       240
     YDWVKEGYGE AGGTPLVPET KASQAAHV                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page