(data stored in ACNUC7421 zone)

EMBL: CP002116.PE62

CP002116.PE62        Location/Qualifiers
FT   CDS             68033..69451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0062"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: ttr:Tter_1698 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: FeS assembly
FT                   protein SufB; TIGRFAM: FeS assembly protein SufB; PFAM:
FT                   Uncharacterized protein family (UPF0051); TIGRFAM: FeS
FT                   assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79222"
FT                   /db_xref="GOA:E1R6U0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U0"
FT                   /protein_id="ADK79222.1"
FT                   /translation="MSETNTMEAVAGIGDDAYKLGFHYPEHSIIKTKKGLSEEVVREIS
FT                   AAKGEAAWMLEFRLAALETFRKMPMPGWGSDLSGIDFDDYYYYAKPVNEQSGSWEELPQ
FT                   DIRDTYERLGIPEAERRFLGGVGAQYDSEMVYHKIRKDFESKGILFMDTETGEREHEEL
FT                   FRKYFASVVPSTDNKFAALNAAVWSGGSFVYVPKGVKVDIPLQAYFRINTKSLAQFERT
FT                   LIVVDEGAFVHYIEGCTAPIYAKDSLHTGVVEIVALPGARVRYSTIQNWSTNVYNLVTQ
FT                   RAKAHAGASVEWVDGNIGSKSTMKYPCVVLAGEGAHGEVLSIAFAGRGQEQDAGGKMIH
FT                   LANNTSSVITSKSISKDGGISSYRGLVKVAPHLRGVKSKVECDALILDEKSTSNTYPTM
FT                   DIQTDDVRMEHEAKVSKISEEELFYLQSRGIDEEEAAKMIVAGFIDPLVRELPMEYAVE
FT                   LNRLIDLEMEGAVG"
     MSETNTMEAV AGIGDDAYKL GFHYPEHSII KTKKGLSEEV VREISAAKGE AAWMLEFRLA        60
     ALETFRKMPM PGWGSDLSGI DFDDYYYYAK PVNEQSGSWE ELPQDIRDTY ERLGIPEAER       120
     RFLGGVGAQY DSEMVYHKIR KDFESKGILF MDTETGEREH EELFRKYFAS VVPSTDNKFA       180
     ALNAAVWSGG SFVYVPKGVK VDIPLQAYFR INTKSLAQFE RTLIVVDEGA FVHYIEGCTA       240
     PIYAKDSLHT GVVEIVALPG ARVRYSTIQN WSTNVYNLVT QRAKAHAGAS VEWVDGNIGS       300
     KSTMKYPCVV LAGEGAHGEV LSIAFAGRGQ EQDAGGKMIH LANNTSSVIT SKSISKDGGI       360
     SSYRGLVKVA PHLRGVKSKV ECDALILDEK STSNTYPTMD IQTDDVRMEH EAKVSKISEE       420
     ELFYLQSRGI DEEEAAKMIV AGFIDPLVRE LPMEYAVELN RLIDLEMEGA VG               472
//

If you have problems or comments...

PBIL Back to PBIL home page