(data stored in ACNUC7421 zone)

EMBL: CP002116.PE63

CP002116.PE63        Location/Qualifiers
FT   CDS             69451..70740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0063"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: acr:Acry_2270 FeS assembly protein SufD;
FT                   PFAM: SufBD protein; SPTR: FeS assembly protein SufD; PFAM:
FT                   Uncharacterized protein family (UPF0051)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79223"
FT                   /db_xref="GOA:E1R6U1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U1"
FT                   /protein_id="ADK79223.1"
FT                   /translation="MNERTMEATRLSWLSEHKNKADAAWKQLPWPGRKNPQWKNSPVSL
FT                   FEAETFTAEQDWEEHAWDTADTSSGPQVTASGAIDDDRYAAVLRFVDGKPDFDKQTIES
FT                   RGIELSFGAAPEWGARFLEAADLSDKLHARLFAEAAPVMSLSIAPGVNLAGPILLDWVD
FT                   GRPDFYAAPLFFLKIGEAAQLRLTLCWRTPDGRKTRLFLSPALFVDLERNARLDLFELE
FT                   HLSHRARFLDYPVAILEEKAELRWSRGIFGVGVSKSTILARLEGRASRFDFAAAYASPD
FT                   KSHVDISVTQRHIAPFTWSRSRLDAVADGSGKAISHGLIEVKESGIGTDAYLSTKTLSL
FT                   SPHAKAVSLPELAIDTNDLTASHGSTVGTISPEELFYLASRGIEIGEAKALIAEGVLGL
FT                   ILERTPSELTDTLESLIEDALETESEVARG"
     MNERTMEATR LSWLSEHKNK ADAAWKQLPW PGRKNPQWKN SPVSLFEAET FTAEQDWEEH        60
     AWDTADTSSG PQVTASGAID DDRYAAVLRF VDGKPDFDKQ TIESRGIELS FGAAPEWGAR       120
     FLEAADLSDK LHARLFAEAA PVMSLSIAPG VNLAGPILLD WVDGRPDFYA APLFFLKIGE       180
     AAQLRLTLCW RTPDGRKTRL FLSPALFVDL ERNARLDLFE LEHLSHRARF LDYPVAILEE       240
     KAELRWSRGI FGVGVSKSTI LARLEGRASR FDFAAAYASP DKSHVDISVT QRHIAPFTWS       300
     RSRLDAVADG SGKAISHGLI EVKESGIGTD AYLSTKTLSL SPHAKAVSLP ELAIDTNDLT       360
     ASHGSTVGTI SPEELFYLAS RGIEIGEAKA LIAEGVLGLI LERTPSELTD TLESLIEDAL       420
     ETESEVARG                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page