(data stored in ACNUC7421 zone)

EMBL: CP002116.PE65

CP002116.PE65        Location/Qualifiers
FT   CDS             72019..72483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0065"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR011341:IPR002871; KEGG: sha:SH2036
FT                   hypothetical protein; PFAM: nitrogen-fixing NifU domain
FT                   protein; SPTR: SUF system FeS assembly protein, NifU
FT                   family; TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: NifU-like N terminal domain; TIGRFAM: SUF
FT                   system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79225"
FT                   /db_xref="GOA:E1R6U3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U3"
FT                   /protein_id="ADK79225.1"
FT                   /translation="MSTIEREVDREIIYDHYTRPRHFGALGPDAVMLENPSCGDTVRLS
FT                   IRGGISSDGSEPLEFRFEGKGCSISQSSTSMMVELLSGKSRGEAIRIAERVLSVFRGER
FT                   DPHVLEDLGDISALAGIARLPVRVKCAALAWQGALKLLRQQERAYSEVDR"
     MSTIEREVDR EIIYDHYTRP RHFGALGPDA VMLENPSCGD TVRLSIRGGI SSDGSEPLEF        60
     RFEGKGCSIS QSSTSMMVEL LSGKSRGEAI RIAERVLSVF RGERDPHVLE DLGDISALAG       120
     IARLPVRVKC AALAWQGALK LLRQQERAYS EVDR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page