(data stored in ACNUC7421 zone)

EMBL: CP002116.PE66

CP002116.PE66        Location/Qualifiers
FT   CDS             complement(72493..73500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0066"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: oan:Oant_4373 regulatory protein
FT                   LacI; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; SPTR: Regulatory protein LacI; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79226"
FT                   /db_xref="GOA:E1R6U4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U4"
FT                   /protein_id="ADK79226.1"
FT                   /translation="MKVTLKDIANYAEVSSATVSLVLNNKGNISPETRDRVLKAIRHFD
FT                   YNKSHGPASQQRTIKFLKIAKHGQVINRDHDVFIADYLDGLTSGAQELDYKLEVVSFAH
FT                   TSVADIIASALQEPSISGAIVLATELNRDDMLLFSTTTIPIVFIDTYNEYLPFDFVDMD
FT                   NKSSIYKAFIYLKELGFPEIGFVASYSDISNFRIRENAYKESISYYPDMNPDIISVEST
FT                   FHGAYRDMNAYLEEHKKLTHKAYICSNDIMALGTIKALKEHGFRIPEDVSLLGFDNLPQ
FT                   SAQADPPLSTIEVSKRDIASIAVKQLHNRIEAPGSPTVRSLVGGALILRESIRR"
     MKVTLKDIAN YAEVSSATVS LVLNNKGNIS PETRDRVLKA IRHFDYNKSH GPASQQRTIK        60
     FLKIAKHGQV INRDHDVFIA DYLDGLTSGA QELDYKLEVV SFAHTSVADI IASALQEPSI       120
     SGAIVLATEL NRDDMLLFST TTIPIVFIDT YNEYLPFDFV DMDNKSSIYK AFIYLKELGF       180
     PEIGFVASYS DISNFRIREN AYKESISYYP DMNPDIISVE STFHGAYRDM NAYLEEHKKL       240
     THKAYICSND IMALGTIKAL KEHGFRIPED VSLLGFDNLP QSAQADPPLS TIEVSKRDIA       300
     SIAVKQLHNR IEAPGSPTVR SLVGGALILR ESIRR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page