(data stored in ACNUC7421 zone)

EMBL: CP002116.PE68

CP002116.PE68        Location/Qualifiers
FT   CDS             74694..75659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bcl:ABC3606 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Tripartite tricarboxylate
FT                   transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79228"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U6"
FT                   /protein_id="ADK79228.1"
FT                   /translation="MKKKITMVLIALLAVGTLCFANGQSEGQPFPAKEVTIVVPYSPGG
FT                   ASDTVTRIIAKNTESALGVPVIVTNKTGASGSIGMDYVRKSTPDGYTISYMPVESTMVS
FT                   ALGYTDLAPADFDFVAGAMTLSAALTVRADAPWDSVEEFLAYAKANPGKLNIGNSGTGS
FT                   IWHIAAASIEESQGVQFNHVPFEGAAPAIAALLGGHIDAITVSDAEVLPNVKNGDFKVL
FT                   AVMGNERSATLPEVPTLKDLGIDVAVFGWGGFAVPKGTPDDVKAILGAAFKVGIGSADF
FT                   AQLCKERGFTQKYMTGKEIQEFAQEQYEYYSKLIPKLGIH"
     MKKKITMVLI ALLAVGTLCF ANGQSEGQPF PAKEVTIVVP YSPGGASDTV TRIIAKNTES        60
     ALGVPVIVTN KTGASGSIGM DYVRKSTPDG YTISYMPVES TMVSALGYTD LAPADFDFVA       120
     GAMTLSAALT VRADAPWDSV EEFLAYAKAN PGKLNIGNSG TGSIWHIAAA SIEESQGVQF       180
     NHVPFEGAAP AIAALLGGHI DAITVSDAEV LPNVKNGDFK VLAVMGNERS ATLPEVPTLK       240
     DLGIDVAVFG WGGFAVPKGT PDDVKAILGA AFKVGIGSAD FAQLCKERGF TQKYMTGKEI       300
     QEFAQEQYEY YSKLIPKLGI H                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page