(data stored in ACNUC7421 zone)

EMBL: CP002116.PE69

CP002116.PE69        Location/Qualifiers
FT   CDS             75729..76175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tle:Tlet_0634 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79229"
FT                   /db_xref="GOA:E1R6U7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U7"
FT                   /protein_id="ADK79229.1"
FT                   /translation="MLYGDLVFGAVSLGLSVWFFIMSLGFPSGSSSNGVPGAGFFPGVI
FT                   SILIALVSIVLMVQGFRQKRHYFQPVKSIKEMPTNTRNLFLTIVSLMIFMLLWKFVHFF
FT                   VAIGAFIFFLNVLFRQKLLVNIIYTVVSIAFIYLTFGKIFHVMF"
     MLYGDLVFGA VSLGLSVWFF IMSLGFPSGS SSNGVPGAGF FPGVISILIA LVSIVLMVQG        60
     FRQKRHYFQP VKSIKEMPTN TRNLFLTIVS LMIFMLLWKF VHFFVAIGAF IFFLNVLFRQ       120
     KLLVNIIYTV VSIAFIYLTF GKIFHVMF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page