(data stored in ACNUC7421 zone)

EMBL: CP002116.PE7

CP002116.PE7         Location/Qualifiers
FT   CDS             4683..5030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0007"
FT                   /product="ribonuclease P protein component"
FT                   /note="InterPro IPR000100:IPR020539; KEGG: tde:TDE2399
FT                   ribonuclease P protein component; PFAM: ribonuclease P
FT                   protein; SPTR: Ribonuclease P protein component; TIGRFAM:
FT                   ribonuclease P protein component; manually curated; PFAM:
FT                   Ribonuclease P; TIGRFAM: ribonuclease P protein component,
FT                   eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79167"
FT                   /db_xref="GOA:E1R6N5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N5"
FT                   /protein_id="ADK79167.1"
FT                   /translation="MKHSADIGRVFSSRTRVSCLGAKLMYRTNNTERNRFTVTLVRKYG
FT                   NAVQRNRAKRVAREAYRLIKPEIRQGYDMVLLLYRSEDTLSNRSRQLSDLLHKAQLLGK
FT                   RHPLFLSIKDQ"
     MKHSADIGRV FSSRTRVSCL GAKLMYRTNN TERNRFTVTL VRKYGNAVQR NRAKRVAREA        60
     YRLIKPEIRQ GYDMVLLLYR SEDTLSNRSR QLSDLLHKAQ LLGKRHPLFL SIKDQ            115
//

If you have problems or comments...

PBIL Back to PBIL home page