(data stored in ACNUC7421 zone)

EMBL: CP002116.PE70

CP002116.PE70        Location/Qualifiers
FT   CDS             76198..77709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0070"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: bcl:ABC3604 hypothetical protein;
FT                   PFAM: protein of unknown function DUF112 transmembrane;
FT                   SPTR: Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79230"
FT                   /db_xref="GOA:E1R6U8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U8"
FT                   /protein_id="ADK79230.1"
FT                   /translation="MGIWLHVLQSLLNPGVLLYLLFGVVIGSFLGGLPGLTATMGIAIL
FT                   TPITFWFSPEKGFAMLIGVWNSAIWAGGLTAILVNTPGTPASIATTFDGFALTKLGKAK
FT                   LALQINTVFSVFGGLFSTLILIVAAFPLAKLAIKFGPAEYFMLGLFGLTMMISVSGNSL
FT                   TKGALMGFAGLLVSTIGLDPILAAKRFTFGITDLLMGVSFIPVMIGMFGVGEVLYQISV
FT                   SKSDDFIERDENASDKPIDLGKDHLTLKMIWEMGPLAFLMAAVATVVGAIPAAGGDIAS
FT                   IICWGQAKRLSRHPEKYGKGSEEGLATSCIANNGVLGGALTTMLTLGIPGDAATAIMIG
FT                   SLMMYGMQPGPRMFVENKEFVITIMLLMIFANIIILLYGLLTTKASIKLLSVKKQFIWV
FT                   TVLILCIVGSFALNNSMFDVVVMLIAGFLGFFMKRMDYAPGPFILGLLLGKIIESNLRR
FT                   ALSLTQGSYSFLLTHPIVIVLEVLIILALIGPLVKKLRNGRKAVA"
     MGIWLHVLQS LLNPGVLLYL LFGVVIGSFL GGLPGLTATM GIAILTPITF WFSPEKGFAM        60
     LIGVWNSAIW AGGLTAILVN TPGTPASIAT TFDGFALTKL GKAKLALQIN TVFSVFGGLF       120
     STLILIVAAF PLAKLAIKFG PAEYFMLGLF GLTMMISVSG NSLTKGALMG FAGLLVSTIG       180
     LDPILAAKRF TFGITDLLMG VSFIPVMIGM FGVGEVLYQI SVSKSDDFIE RDENASDKPI       240
     DLGKDHLTLK MIWEMGPLAF LMAAVATVVG AIPAAGGDIA SIICWGQAKR LSRHPEKYGK       300
     GSEEGLATSC IANNGVLGGA LTTMLTLGIP GDAATAIMIG SLMMYGMQPG PRMFVENKEF       360
     VITIMLLMIF ANIIILLYGL LTTKASIKLL SVKKQFIWVT VLILCIVGSF ALNNSMFDVV       420
     VMLIAGFLGF FMKRMDYAPG PFILGLLLGK IIESNLRRAL SLTQGSYSFL LTHPIVIVLE       480
     VLIILALIGP LVKKLRNGRK AVA                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page