(data stored in ACNUC7421 zone)

EMBL: CP002116.PE71

CP002116.PE71        Location/Qualifiers
FT   CDS             77737..78747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0071"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006; KEGG: oan:Oant_4368 glycerone kinase; PFAM: Dak
FT                   kinase; PRIAM: Glycerone kinase; SPTR: Glycerone kinase;
FT                   PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79231"
FT                   /db_xref="GOA:E1R6U9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U9"
FT                   /protein_id="ADK79231.1"
FT                   /translation="MKKFLNAPEAFVDEMLEGIMAAHPDQMSYVNDDIRCVVRKDLSKK
FT                   KVALASGGGSGHLPTFMGYVGEGMLDGCPVGGVFQSPSSDQMYEVTKAIDRGAGVLYIY
FT                   GNYSGDIINFDMAAELADFDDIRVETVVAADDVASAPKSETEKRRGVAGIFYLFKIAGA
FT                   AAEAGMDMDEVKRVAEKVNGRVATMGVALSPCIIPDVGKPSFTIGEDEMEIGMGIHGEP
FT                   GIRRGKLRSADEVVNEILPKLIDDLSPESGSEVSILVNGLGATPKEELYIIYRRIAQVL
FT                   KERGLKPVKIYCGEFATSMEMAGFSISMICLDDELKKFLAAPACTPFFEQGELEL"
     MKKFLNAPEA FVDEMLEGIM AAHPDQMSYV NDDIRCVVRK DLSKKKVALA SGGGSGHLPT        60
     FMGYVGEGML DGCPVGGVFQ SPSSDQMYEV TKAIDRGAGV LYIYGNYSGD IINFDMAAEL       120
     ADFDDIRVET VVAADDVASA PKSETEKRRG VAGIFYLFKI AGAAAEAGMD MDEVKRVAEK       180
     VNGRVATMGV ALSPCIIPDV GKPSFTIGED EMEIGMGIHG EPGIRRGKLR SADEVVNEIL       240
     PKLIDDLSPE SGSEVSILVN GLGATPKEEL YIIYRRIAQV LKERGLKPVK IYCGEFATSM       300
     EMAGFSISMI CLDDELKKFL AAPACTPFFE QGELEL                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page