(data stored in ACNUC7421 zone)

EMBL: CP002116.PE72

CP002116.PE72        Location/Qualifiers
FT   CDS             78750..79388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0072"
FT                   /product="Dak phosphatase"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004007; KEGG: oan:Oant_4367 Dak phosphatase; PFAM: Dak
FT                   phosphatase; SPTR: Dak phosphatase; PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79232"
FT                   /db_xref="GOA:E1R6V0"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V0"
FT                   /protein_id="ADK79232.1"
FT                   /translation="MAERTKERAAVDAVLASISGIMSENREFLIKIDGVIGDGDLGITM
FT                   DKAFSAAAEGVVSLDEPQVPKALIEAGKIMAKNAPSTMGTLMATGFMYGGKALGEEEML
FT                   SAGGLYAFFKGFLEGVEKRGKAKPGEKTLLDVLDPVVRALEAKQEADLSDALEAAMKAA
FT                   EEGLKATEKMVSQHGKAAVYREQTLGKQDPGATAMLFVVKGFREALTTL"
     MAERTKERAA VDAVLASISG IMSENREFLI KIDGVIGDGD LGITMDKAFS AAAEGVVSLD        60
     EPQVPKALIE AGKIMAKNAP STMGTLMATG FMYGGKALGE EEMLSAGGLY AFFKGFLEGV       120
     EKRGKAKPGE KTLLDVLDPV VRALEAKQEA DLSDALEAAM KAAEEGLKAT EKMVSQHGKA       180
     AVYREQTLGK QDPGATAMLF VVKGFREALT TL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page