(data stored in ACNUC7421 zone)

EMBL: CP002116.PE77

CP002116.PE77        Location/Qualifiers
FT   CDS             83108..83692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: bpf:BpOF4_12170 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator (TetR family); PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79237"
FT                   /db_xref="GOA:E1R893"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R893"
FT                   /protein_id="ADK79237.1"
FT                   /translation="MTGHEKRTLKKKENIKNASIELFSLYGIKKVSMNEIAEKAQVSKV
FT                   SIYKYFNSKDDLIRYVIKAVSSEILSDINNIIESENPFPEKVKMIIMNKNQGLKFLRGD
FT                   FFTELLSLDEVLNNYYEHEFKEKANSLMSKFIELGKTSGFIDKKVKTATILTYIHIFQK
FT                   GVESNIGTLSGRDDISELIQLFFFGILSKQK"
     MTGHEKRTLK KKENIKNASI ELFSLYGIKK VSMNEIAEKA QVSKVSIYKY FNSKDDLIRY        60
     VIKAVSSEIL SDINNIIESE NPFPEKVKMI IMNKNQGLKF LRGDFFTELL SLDEVLNNYY       120
     EHEFKEKANS LMSKFIELGK TSGFIDKKVK TATILTYIHI FQKGVESNIG TLSGRDDISE       180
     LIQLFFFGIL SKQK                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page