(data stored in ACNUC7421 zone)

EMBL: CP002116.PE79

CP002116.PE79        Location/Qualifiers
FT   CDS             84057..84623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0079"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: rpe:RPE_3675 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR:
FT                   Transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79239"
FT                   /db_xref="GOA:E1R895"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R895"
FT                   /protein_id="ADK79239.1"
FT                   /translation="MSSRPLISACALKLFAERGYDAVGVQEIVDAAGITKPSLYHHFGS
FT                   KKGLLEQLIAPLFQEVNEALARAASYHHDLPRNLDQAAACFFSFAEKQPLFSRLMLSMI
FT                   HAPLKSEARLVVQPWLEEQYHTFENLFRLASGDHGNMKGRSKPFAATFLGMLHTYVSLF
FT                   LDGNTDFDERVRHEAVRQFSYGIYS"
     MSSRPLISAC ALKLFAERGY DAVGVQEIVD AAGITKPSLY HHFGSKKGLL EQLIAPLFQE        60
     VNEALARAAS YHHDLPRNLD QAAACFFSFA EKQPLFSRLM LSMIHAPLKS EARLVVQPWL       120
     EEQYHTFENL FRLASGDHGN MKGRSKPFAA TFLGMLHTYV SLFLDGNTDF DERVRHEAVR       180
     QFSYGIYS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page