(data stored in ACNUC7421 zone)

EMBL: CP002116.PE8

CP002116.PE8         Location/Qualifiers
FT   CDS             5039..6796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0008"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COGs: COG0706 Preprotein translocase subunit YidC;
FT                   InterPro IPR001708:IPR013308:IPR019998:IPR020001; KEGG:
FT                   tde:TDE2396 putative inner membrane protein translocase
FT                   component YidC; PFAM: 60 kDa inner membrane insertion
FT                   protein; SPTR: Inner membrane protein OxaA; TIGRFAM:
FT                   membrane protein insertase, YidC/Oxa1 family; membrane
FT                   protein insertase, YidC/Oxa1 family domain containing;
FT                   PFAM: 60Kd inner membrane protein; TIGRFAM: membrane
FT                   protein insertase, YidC/Oxa1 family, C-terminal domain;
FT                   membrane protein insertase, YidC/Oxa1 family, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79168"
FT                   /db_xref="GOA:E1R6N6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N6"
FT                   /protein_id="ADK79168.1"
FT                   /translation="MDKRTLLAVILSTIVISVGFMIQNTFFAPPLPESPAVTEQAEASG
FT                   NTNASDGSVSSNDNSQQQPTAPVLQAQGIIPFGDEPGEKMVSLDTKVFKATFSSRGALL
FT                   TSMKLKEHFENGEPLEMIWRGNDAEGAFGISFGGPEREIAHVPFFVRNIDENTLEFYRE
FT                   FAVQTSSGPVPFTLTKRFRFNPSDYLFEVLVKIENSVNAYPALDEDGYAYTLSFGPQIG
FT                   PQVEKMDGRYAYRRYFTYENGKQKNYRMKNGSVSVDNRVSWAAVLGKYFAVIGVPDATD
FT                   YDLLFTEGSEPGLPTTSRLFFSRPPLKSSVSEDVFRFYMGPKISRVLTQYNDPDKNGFG
FT                   TRDLHLEEVMDQGRLLGWLEVIMKKLLVFFYSIIPNWGVAIILLTILVKVVLFPITHKS
FT                   YESTSKMQMLQPKMKEIQDKYRDNPNKMNQEMAELYKREKVNPMGGCLPMLLQMPMFIA
FT                   MYGLFNKYFDLRGSSFIPGWITDLSSPESVYSFAPFKIPILGWSDIRLLPMFFVATMIL
FT                   SSKMTQSPSSAGSQNSSMKMMTYMMPIFFFFFLYNAPSGLLVYWIVTNVLTIGQQKAIS
FT                   KIQKRKEEG"
     MDKRTLLAVI LSTIVISVGF MIQNTFFAPP LPESPAVTEQ AEASGNTNAS DGSVSSNDNS        60
     QQQPTAPVLQ AQGIIPFGDE PGEKMVSLDT KVFKATFSSR GALLTSMKLK EHFENGEPLE       120
     MIWRGNDAEG AFGISFGGPE REIAHVPFFV RNIDENTLEF YREFAVQTSS GPVPFTLTKR       180
     FRFNPSDYLF EVLVKIENSV NAYPALDEDG YAYTLSFGPQ IGPQVEKMDG RYAYRRYFTY       240
     ENGKQKNYRM KNGSVSVDNR VSWAAVLGKY FAVIGVPDAT DYDLLFTEGS EPGLPTTSRL       300
     FFSRPPLKSS VSEDVFRFYM GPKISRVLTQ YNDPDKNGFG TRDLHLEEVM DQGRLLGWLE       360
     VIMKKLLVFF YSIIPNWGVA IILLTILVKV VLFPITHKSY ESTSKMQMLQ PKMKEIQDKY       420
     RDNPNKMNQE MAELYKREKV NPMGGCLPML LQMPMFIAMY GLFNKYFDLR GSSFIPGWIT       480
     DLSSPESVYS FAPFKIPILG WSDIRLLPMF FVATMILSSK MTQSPSSAGS QNSSMKMMTY       540
     MMPIFFFFFL YNAPSGLLVY WIVTNVLTIG QQKAISKIQK RKEEG                       585
//

If you have problems or comments...

PBIL Back to PBIL home page