(data stored in ACNUC7421 zone)

EMBL: CP002116.PE80

CP002116.PE80        Location/Qualifiers
FT   CDS             84638..85978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0080"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: hau:Haur_2435 alpha amylase
FT                   catalytic region; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Alpha amylase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79240"
FT                   /db_xref="GOA:E1R896"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E1R896"
FT                   /protein_id="ADK79240.1"
FT                   /translation="MSSWWNDARIYHIFPMGFCGAPHTNDFSSPAEHRILKIIDWLDPI
FT                   RRMGFDTILLGPVFESTSHGYDTVDFYHIDRRLGNNESFAGFAEEVHRRGMRLMLDGVF
FT                   NHVGRDFWAFYDLRQKGAASDYVSWFDGVSFSSPGFGDDGFSYTGWEGHQELVQLALSN
FT                   TEVKDHLFGAIRAMRERFGVDGLRLDVAYNLDEGFLRKLAGFCRSLDPDFTLLGEVIHG
FT                   DYGRYLHSNGLDSVTNYECYKGIYSSHNDGNFFEIAWSLNRLFGEEGLCHGLPLFNFVD
FT                   NHDVSRIASILKDRADLPTVYALLCTIPGVPSLYYGSEWESPGVKESGSDWNLRPPAEQ
FT                   IERSGSRLPELIRGLLSLRNGHPALCRGDYRQVHVASRQLAFVRNYGDDWVLILLNSAD
FT                   RSVPIPLKEVPLRELRDTLTGEIAGAQPELGPKSFRIFSTQGPEERV"
     MSSWWNDARI YHIFPMGFCG APHTNDFSSP AEHRILKIID WLDPIRRMGF DTILLGPVFE        60
     STSHGYDTVD FYHIDRRLGN NESFAGFAEE VHRRGMRLML DGVFNHVGRD FWAFYDLRQK       120
     GAASDYVSWF DGVSFSSPGF GDDGFSYTGW EGHQELVQLA LSNTEVKDHL FGAIRAMRER       180
     FGVDGLRLDV AYNLDEGFLR KLAGFCRSLD PDFTLLGEVI HGDYGRYLHS NGLDSVTNYE       240
     CYKGIYSSHN DGNFFEIAWS LNRLFGEEGL CHGLPLFNFV DNHDVSRIAS ILKDRADLPT       300
     VYALLCTIPG VPSLYYGSEW ESPGVKESGS DWNLRPPAEQ IERSGSRLPE LIRGLLSLRN       360
     GHPALCRGDY RQVHVASRQL AFVRNYGDDW VLILLNSADR SVPIPLKEVP LRELRDTLTG       420
     EIAGAQPELG PKSFRIFSTQ GPEERV                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page