(data stored in ACNUC7421 zone)

EMBL: CP002116.PE81

CP002116.PE81        Location/Qualifiers
FT   CDS             complement(85975..86556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0081"
FT                   /product="pentapeptide repeat protein"
FT                   /note="InterPro IPR001646; KEGG: cli:Clim_1473 pentapeptide
FT                   repeat protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Pentapeptide repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79241"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R897"
FT                   /protein_id="ADK79241.1"
FT                   /translation="MISEKQYHCDAQFTQNDMVDMDFTDHTFENCSFSNCRFSELRMAG
FT                   TAFISCVFETCEFVVTEIQNVSFNDTLFDACKLLGINFTNCNDFGFSPRFKACLMKTVV
FT                   FNNKNLKSMPFESCEIVDCDFTESDLRDADFSNSFFKGTRFHQCDLRKADFRTARGYEI
FT                   NPITNKIVQARFTLPEAQSFLLFLGIDLGP"
     MISEKQYHCD AQFTQNDMVD MDFTDHTFEN CSFSNCRFSE LRMAGTAFIS CVFETCEFVV        60
     TEIQNVSFND TLFDACKLLG INFTNCNDFG FSPRFKACLM KTVVFNNKNL KSMPFESCEI       120
     VDCDFTESDL RDADFSNSFF KGTRFHQCDL RKADFRTARG YEINPITNKI VQARFTLPEA       180
     QSFLLFLGID LGP                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page