(data stored in ACNUC7421 zone)

EMBL: CP002116.PE82

CP002116.PE82        Location/Qualifiers
FT   CDS             86655..87179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0082"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: tde:TDE1505 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: Membrane protein,
FT                   putative; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79242"
FT                   /db_xref="GOA:E1R898"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1R898"
FT                   /protein_id="ADK79242.1"
FT                   /translation="MMFFSPPFVWGLIGVLLIAFEMVIPGFTIFFFGAGALLTALVSAV
FT                   VPPVASNIGSQLLLWAVSSVLSFAFLRRHFAKIFRGTVLNRSISNEGLGEVVTVLETIS
FT                   PDKPGRVRYRGTSWKAVSLTETFEPGNKAEIIEISGLTLTVTAPFEGIGRDEFLDRLED
FT                   PSSPKSGETTL"
     MMFFSPPFVW GLIGVLLIAF EMVIPGFTIF FFGAGALLTA LVSAVVPPVA SNIGSQLLLW        60
     AVSSVLSFAF LRRHFAKIFR GTVLNRSISN EGLGEVVTVL ETISPDKPGR VRYRGTSWKA       120
     VSLTETFEPG NKAEIIEISG LTLTVTAPFE GIGRDEFLDR LEDPSSPKSG ETTL             174
//

If you have problems or comments...

PBIL Back to PBIL home page