(data stored in ACNUC7421 zone)

EMBL: CP002116.PE83

CP002116.PE83        Location/Qualifiers
FT   CDS             87220..88134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0083"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:IPR001107;
FT                   KEGG: tde:TDE0705 SPFH domain-containing protein/band 7
FT                   family protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: SPFH domain/Band 7 family protein; PFAM:
FT                   SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79243"
FT                   /db_xref="GOA:E1R899"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1R899"
FT                   /protein_id="ADK79243.1"
FT                   /translation="MNVILAYLLAFVVIVIFFKLIRIVPEQEVYIIERFGKYEKSLGSG
FT                   LHLVIPFVQRVAYKHTLKEEVIDVDPQVCITADNVQVTVDGLLYLRVMDAEKASYGIDN
FT                   YRYATAQLAKTTMRSEIGKLDLDRSFSERDEINDAIVRAVDEASDPWGIKVTRYEIKDI
FT                   RPTDTIEQAMEQQMRAEREKRAEILASEGEKMSRINISQGDREAAINLSKGERQRRINE
FT                   AEGRSKAIEVTSVATAEGLQMIAEALQLPKGKAAMGLRLAEQYLTKFGSILDTAETTVL
FT                   PDDLARLKSLIDTVAPGIAGGKV"
     MNVILAYLLA FVVIVIFFKL IRIVPEQEVY IIERFGKYEK SLGSGLHLVI PFVQRVAYKH        60
     TLKEEVIDVD PQVCITADNV QVTVDGLLYL RVMDAEKASY GIDNYRYATA QLAKTTMRSE       120
     IGKLDLDRSF SERDEINDAI VRAVDEASDP WGIKVTRYEI KDIRPTDTIE QAMEQQMRAE       180
     REKRAEILAS EGEKMSRINI SQGDREAAIN LSKGERQRRI NEAEGRSKAI EVTSVATAEG       240
     LQMIAEALQL PKGKAAMGLR LAEQYLTKFG SILDTAETTV LPDDLARLKS LIDTVAPGIA       300
     GGKV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page