(data stored in ACNUC7421 zone)

EMBL: CP002116.PE84

CP002116.PE84        Location/Qualifiers
FT   CDS             88131..89051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0084"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:IPR001107;
FT                   KEGG: tde:TDE0704 SPFH domain-containing protein/band 7
FT                   family protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: SPFH domain/Band 7 family protein; PFAM:
FT                   SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79244"
FT                   /db_xref="GOA:E1R8A0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A0"
FT                   /protein_id="ADK79244.1"
FT                   /translation="MNPFLPLMVLIFLFGVVILVSLIRSVRIVPGKVALVVERLGKYSR
FT                   TLEAGFHVLVPFIERVKYRHGLKEVAVDVPAQDCFTQDNVKVRVDGVLYMKVVDARRAS
FT                   YGITNYQYATIQLAQTTMRSVIGRLELDKTFEERDAINAEVVKAVDEAADAWGVKVSRY
FT                   EIQNINVPSGILEAMEVQMRAEREKRAAIARSLGEKESKINYSQAEMEEAVNRSEGVKE
FT                   KMINEAEGKAQEILSLARATADGIKMVARSVANQGGEDALALRVAEGYIEELSKLAKQQ
FT                   TRVVVPMDVTDMAAMMTKVERMVKE"
     MNPFLPLMVL IFLFGVVILV SLIRSVRIVP GKVALVVERL GKYSRTLEAG FHVLVPFIER        60
     VKYRHGLKEV AVDVPAQDCF TQDNVKVRVD GVLYMKVVDA RRASYGITNY QYATIQLAQT       120
     TMRSVIGRLE LDKTFEERDA INAEVVKAVD EAADAWGVKV SRYEIQNINV PSGILEAMEV       180
     QMRAEREKRA AIARSLGEKE SKINYSQAEM EEAVNRSEGV KEKMINEAEG KAQEILSLAR       240
     ATADGIKMVA RSVANQGGED ALALRVAEGY IEELSKLAKQ QTRVVVPMDV TDMAAMMTKV       300
     ERMVKE                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page