(data stored in ACNUC7421 zone)

EMBL: CP002116.PE85

CP002116.PE85        Location/Qualifiers
FT   CDS             89242..90681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1626 Neutral trehalase; InterPro IPR019775;
FT                   KEGG: tde:TDE0996 hypothetical protein; SPTR: Trehalase;
FT                   PFAM: Trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79245"
FT                   /db_xref="GOA:E1R8A1"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A1"
FT                   /protein_id="ADK79245.1"
FT                   /translation="MHNSLISKKGFPIVHFYDQDFVDIYEKSWAWIEEAWYRNGEKNGL
FT                   QEQFFRYPGGDTINQAEACMSTFFLVYSNRLFSAFHNLDNFYGKQESDGAIRCTYRIDD
FT                   GNPVLTEENPLGVGPPLFALAEYNLFHKVGNKKRLKEIMPYLEAYYAWLELNFKDDTGL
FT                   YVVPAEASMMENAPRDRAVYLLDFNAQQAVNALYMSAIGDVLNDKEISFRYKRNYFSLK
FT                   TRINSQMWDEESGFYYDLDKEGKRLNEKMIGAYWTLLAEIPNEDKSNALIAHLKNPETF
FT                   GTEHPFPSLAVDSPHFTENGYGCRGSVYPSLNFVVIKGLEKYARYELAREASIRHLYFM
FT                   LDTLHPEGDKKGNLWEAYLPHKEGPALWPDSEDFPRPLYLPGIALSTITLMIENVLGLT
FT                   ISLPRKTVDWIVPTLEIMGIENLSLKRNMITILSNKSSRGWEIRLESEKLYYFTITVLD
FT                   EKKKKTLPIPSGKCSMLIDKL"
     MHNSLISKKG FPIVHFYDQD FVDIYEKSWA WIEEAWYRNG EKNGLQEQFF RYPGGDTINQ        60
     AEACMSTFFL VYSNRLFSAF HNLDNFYGKQ ESDGAIRCTY RIDDGNPVLT EENPLGVGPP       120
     LFALAEYNLF HKVGNKKRLK EIMPYLEAYY AWLELNFKDD TGLYVVPAEA SMMENAPRDR       180
     AVYLLDFNAQ QAVNALYMSA IGDVLNDKEI SFRYKRNYFS LKTRINSQMW DEESGFYYDL       240
     DKEGKRLNEK MIGAYWTLLA EIPNEDKSNA LIAHLKNPET FGTEHPFPSL AVDSPHFTEN       300
     GYGCRGSVYP SLNFVVIKGL EKYARYELAR EASIRHLYFM LDTLHPEGDK KGNLWEAYLP       360
     HKEGPALWPD SEDFPRPLYL PGIALSTITL MIENVLGLTI SLPRKTVDWI VPTLEIMGIE       420
     NLSLKRNMIT ILSNKSSRGW EIRLESEKLY YFTITVLDEK KKKTLPIPSG KCSMLIDKL        479
//

If you have problems or comments...

PBIL Back to PBIL home page