(data stored in ACNUC7421 zone)

EMBL: CP002116.PE86

CP002116.PE86        Location/Qualifiers
FT   CDS             complement(90683..91270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0086"
FT                   /product="recombination protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro
FT                   IPR000093:IPR006154:IPR015967:IPR006171; KEGG: tde:TDE1549
FT                   recombination protein RecR; PFAM: TOPRIM domain protein;
FT                   Zinc finger C4-type, RecR; SMART: Toprim sub domain
FT                   protein; SPTR: Recombination protein RecR; TIGRFAM:
FT                   recombination protein RecR; PFAM: Toprim domain; RecR
FT                   protein; TIGRFAM: recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79246"
FT                   /db_xref="GOA:E1R8A2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A2"
FT                   /protein_id="ADK79246.1"
FT                   /translation="MNQLERLIRSLSRLPGVGRKSAARIAHYLLKADSAFVTRLAEEIG
FT                   TLKERIHPCPVCGNFTEDELCSVCSDPRRDGTQICVVEEPQDVATIESTGEYNGLFHVL
FT                   GGAINPMNGVGPSDLSIDKLVKRASEGTVKEIIIATNPTVEGDTTALYLQNILKERPIE
FT                   VSRLASGLPVGGDLEYADKLTLARSFRGRTKL"
     MNQLERLIRS LSRLPGVGRK SAARIAHYLL KADSAFVTRL AEEIGTLKER IHPCPVCGNF        60
     TEDELCSVCS DPRRDGTQIC VVEEPQDVAT IESTGEYNGL FHVLGGAINP MNGVGPSDLS       120
     IDKLVKRASE GTVKEIIIAT NPTVEGDTTA LYLQNILKER PIEVSRLASG LPVGGDLEYA       180
     DKLTLARSFR GRTKL                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page