(data stored in ACNUC7421 zone)

EMBL: CP002116.PE87

CP002116.PE87        Location/Qualifiers
FT   CDS             complement(91272..91604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: ddf:DEFDS_0142 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   BCR, YbaB family COG0718; TIGRFAM: conserved hypothetical
FT                   protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79247"
FT                   /db_xref="GOA:E1R8A3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A3"
FT                   /protein_id="ADK79247.1"
FT                   /translation="MNPMDLFKNMQNLQSGMKDMQEQLKDIVVIGTAGGGMVVIEMNGQ
FT                   MQIIGVRIEREVVDPEDIGMLEDLVRAAFNDAFAKVREEMQNKLSGGLGNLNLPPDLLN
FT                   NLGNPG"
     MNPMDLFKNM QNLQSGMKDM QEQLKDIVVI GTAGGGMVVI EMNGQMQIIG VRIEREVVDP        60
     EDIGMLEDLV RAAFNDAFAK VREEMQNKLS GGLGNLNLPP DLLNNLGNPG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page