(data stored in ACNUC7421 zone)

EMBL: CP002116.PE88

CP002116.PE88        Location/Qualifiers
FT   CDS             complement(91601..93346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0088"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR001270:IPR012763:IPR003593:IPR003959; KEGG:
FT                   tde:TDE2586 DNA polymerase III subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: DNA polymerase III, gamma and tau subunits, putative;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); DNA polymerase III subunits gamma and tau domain
FT                   III; TIGRFAM: DNA polymerase III, delta' subunit; DNA
FT                   polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79248"
FT                   /db_xref="GOA:E1R8A4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A4"
FT                   /protein_id="ADK79248.1"
FT                   /translation="MSYEVTATRKRPQGFETLVGQDFVVSTLSSAVSSGRIAHAYLFSG
FT                   PRGVGKTSAARLLAKALNCEKGPTPAPCGECSSCQEISRGNSLDVIEIDGASNTSVNDV
FT                   REIKDEVLFAPNSGRYKVYIIDEVHMLSNSAFNALLKTIEEPPPYIVFIFATTEIHKVP
FT                   ATIRSRCQQFNFRLIQPETIKNKLAEAAAELQIEAEDEALFWIAKEATGSLRDAYTLFD
FT                   QVASFSDKGITLEEIRQKLGLVGLERINGVAEALAEEDAGKAIELTESVLADGVAVEQF
FT                   IIDLTEYFRNLLFIRHGIKKEAVLGYSPERFSSKARDAWSVSQMETAIELLFTLYREIR
FT                   YSLNQRFELELVMSRLAGMRSYLSPKEVLHQIGKLRSELVEGKLPLGQQQVAGSDNDVP
FT                   ETEPPRSPQIREHAPPQEQVSQAADQSVSQKASNPVHEKSHSDSLSSEEGEEAPPKNSH
FT                   AVVGQTEQAEGPRNLSQEEIQQTIDSLRKTKPALVSALEKAGTWHLEGETLSIDFENGF
FT                   TVNFVRGEIPILADALLPVIGFRPAVKLNAISKEQQQEENDDTEVRLVTEVFRGEVIGP
FT                   KGEKK"
     MSYEVTATRK RPQGFETLVG QDFVVSTLSS AVSSGRIAHA YLFSGPRGVG KTSAARLLAK        60
     ALNCEKGPTP APCGECSSCQ EISRGNSLDV IEIDGASNTS VNDVREIKDE VLFAPNSGRY       120
     KVYIIDEVHM LSNSAFNALL KTIEEPPPYI VFIFATTEIH KVPATIRSRC QQFNFRLIQP       180
     ETIKNKLAEA AAELQIEAED EALFWIAKEA TGSLRDAYTL FDQVASFSDK GITLEEIRQK       240
     LGLVGLERIN GVAEALAEED AGKAIELTES VLADGVAVEQ FIIDLTEYFR NLLFIRHGIK       300
     KEAVLGYSPE RFSSKARDAW SVSQMETAIE LLFTLYREIR YSLNQRFELE LVMSRLAGMR       360
     SYLSPKEVLH QIGKLRSELV EGKLPLGQQQ VAGSDNDVPE TEPPRSPQIR EHAPPQEQVS       420
     QAADQSVSQK ASNPVHEKSH SDSLSSEEGE EAPPKNSHAV VGQTEQAEGP RNLSQEEIQQ       480
     TIDSLRKTKP ALVSALEKAG TWHLEGETLS IDFENGFTVN FVRGEIPILA DALLPVIGFR       540
     PAVKLNAISK EQQQEENDDT EVRLVTEVFR GEVIGPKGEK K                           581
//

If you have problems or comments...

PBIL Back to PBIL home page