(data stored in ACNUC7421 zone)

EMBL: CP002116.PE89

CP002116.PE89        Location/Qualifiers
FT   CDS             complement(94079..94924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0089"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro
FT                   IPR001719:IPR012307:IPR018246; KEGG: nis:NIS_0286
FT                   endonuclease IV; PFAM: Xylose isomerase domain protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79249"
FT                   /db_xref="GOA:E1R8A5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A5"
FT                   /protein_id="ADK79249.1"
FT                   /translation="MKYIGAHVSAAGGVEKAPLHAAEIGAGAFALFTKNQRQWKTKPLE
FT                   EHSIKAFSDHLSQVGISPDHVLPHDSYLINLGSPEEEKWQRAFDAFLDEVRRAEQLGLK
FT                   LLNFHPGSHLKKISEEECIGRIAKAMNRAIAETDSLVLVIENTAGQGSNIGYSFEQLGR
FT                   LVELTENKKRVGVCIDTCHAFAAGYDMRSREAYGHTMAHFDEVVGYSYLRGMHLNDAKS
FT                   EFGSRVDRHAPLGDGNIGIEAFRFLMEDSRLDDIPLILETPEPDRWAQEIKTLYDFAGT
FT                   "
     MKYIGAHVSA AGGVEKAPLH AAEIGAGAFA LFTKNQRQWK TKPLEEHSIK AFSDHLSQVG        60
     ISPDHVLPHD SYLINLGSPE EEKWQRAFDA FLDEVRRAEQ LGLKLLNFHP GSHLKKISEE       120
     ECIGRIAKAM NRAIAETDSL VLVIENTAGQ GSNIGYSFEQ LGRLVELTEN KKRVGVCIDT       180
     CHAFAAGYDM RSREAYGHTM AHFDEVVGYS YLRGMHLNDA KSEFGSRVDR HAPLGDGNIG       240
     IEAFRFLMED SRLDDIPLIL ETPEPDRWAQ EIKTLYDFAG T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page