(data stored in ACNUC7421 zone)

EMBL: CP002116.PE9

CP002116.PE9         Location/Qualifiers
FT   CDS             6836..7519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0009"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="COGs: COG1847 RNA-binding protein; InterPro
FT                   IPR001374:IPR004088; KEGG: tde:TDE2395 Jag protein,
FT                   putative; PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; SPTR: Protein jag; PFAM: R3H domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79169"
FT                   /db_xref="GOA:E1R6N7"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N7"
FT                   /protein_id="ADK79169.1"
FT                   /translation="MVKEFEGKTEKEAIDNAVSALNIDREEFDVEIVESVKGGLFRKGA
FT                   VKIRVFIEDDDDGFDVGDRYSEDVDPQAQDDFEKASVTFLETLIEKMGFPGTVSINFRE
FT                   EKKIGLTIDSQHSGILIGKKGKNLDALQLLVNVYCGKLHEGRRVIVDAENYRSRHEESI
FT                   IRLADRTAAQVRKTKRSRLLEPMNPFERRLVHTTLNDIDDVETRSEGEGLYKQVRIIYK
FT                   GSANY"
     MVKEFEGKTE KEAIDNAVSA LNIDREEFDV EIVESVKGGL FRKGAVKIRV FIEDDDDGFD        60
     VGDRYSEDVD PQAQDDFEKA SVTFLETLIE KMGFPGTVSI NFREEKKIGL TIDSQHSGIL       120
     IGKKGKNLDA LQLLVNVYCG KLHEGRRVIV DAENYRSRHE ESIIRLADRT AAQVRKTKRS       180
     RLLEPMNPFE RRLVHTTLND IDDVETRSEG EGLYKQVRII YKGSANY                     227
//

If you have problems or comments...

PBIL Back to PBIL home page