(data stored in ACNUC7421 zone)

EMBL: CP002116.PE90

CP002116.PE90        Location/Qualifiers
FT   CDS             complement(94928..95251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00046720 TBC domain containing
FT                   protein; SPTR: TBC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79250"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A6"
FT                   /protein_id="ADK79250.1"
FT                   /translation="MDTINSLHDTFVQKLPDTIPADLLFKACSQSFLGKELETICGELV
FT                   DTLNADCSKKDYHLWDYDHLEFIIEQARRFHLFLPKNFVNGLPQQFVLRIEADHLYTPE
FT                   CRN"
     MDTINSLHDT FVQKLPDTIP ADLLFKACSQ SFLGKELETI CGELVDTLNA DCSKKDYHLW        60
     DYDHLEFIIE QARRFHLFLP KNFVNGLPQQ FVLRIEADHL YTPECRN                     107
//

If you have problems or comments...

PBIL Back to PBIL home page