(data stored in ACNUC7421 zone)

EMBL: CP002116.PE91

CP002116.PE91        Location/Qualifiers
FT   CDS             95322..96872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0091"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2509 Uncharacterized FAD-dependent
FT                   dehydrogenase; InterPro IPR006076; KEGG: shi:Shel_15100
FT                   FAD-dependent dehydrogenase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: FAD-dependent dehydrogenase; PFAM:
FT                   FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79251"
FT                   /db_xref="GOA:E1R8A7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A7"
FT                   /protein_id="ADK79251.1"
FT                   /translation="MGYKRYQLSLPTDYGEEDLLGLLRKKSGLTEFRYVIEKKSLDARQ
FT                   KREIHWLLSIVLISDQLSGEPWAAPAPLNVPKKRSPCHVVVVGSGPAGIFSALVLAEAG
FT                   CSVTVIERGSRIEKRKRDIDVFEADSTFPLCNNYAFGEGGAGAFSDGKLTSRSKHIGPE
FT                   RAFIHKAFIEAGAPEEIAWLAHPHLGSDNLFRITRALRAKVGTLGGSFAFDTFLEGFTR
FT                   LSGGGFRLSCKKSIGGEGSEIDGIECDYLIIACGHSADDTIAMMIHSGIPYRTKNFALG
FT                   FRVEHEQRVINHAQWGSSSLPGVKAAEYRLTAADNVYTFCMCPGGRVVPAAAFSDRNIV
FT                   NGMSNYYRDGRFANAAVVAGLHPDQLAGRPVSPPEALELLANLERRFVQTGNGYAAPAA
FT                   SISAFLAGKAPGMLPQESSYPFPLIPADPEALYPKFLLPRLRRGLAQFCSKIRGFDTGT
FT                   ILGLESRTSSSVQVLREQDGSIPQFPGLFVVGEASGWAGGIVSSAADGIRAAMTVVGS"
     MGYKRYQLSL PTDYGEEDLL GLLRKKSGLT EFRYVIEKKS LDARQKREIH WLLSIVLISD        60
     QLSGEPWAAP APLNVPKKRS PCHVVVVGSG PAGIFSALVL AEAGCSVTVI ERGSRIEKRK       120
     RDIDVFEADS TFPLCNNYAF GEGGAGAFSD GKLTSRSKHI GPERAFIHKA FIEAGAPEEI       180
     AWLAHPHLGS DNLFRITRAL RAKVGTLGGS FAFDTFLEGF TRLSGGGFRL SCKKSIGGEG       240
     SEIDGIECDY LIIACGHSAD DTIAMMIHSG IPYRTKNFAL GFRVEHEQRV INHAQWGSSS       300
     LPGVKAAEYR LTAADNVYTF CMCPGGRVVP AAAFSDRNIV NGMSNYYRDG RFANAAVVAG       360
     LHPDQLAGRP VSPPEALELL ANLERRFVQT GNGYAAPAAS ISAFLAGKAP GMLPQESSYP       420
     FPLIPADPEA LYPKFLLPRL RRGLAQFCSK IRGFDTGTIL GLESRTSSSV QVLREQDGSI       480
     PQFPGLFVVG EASGWAGGIV SSAADGIRAA MTVVGS                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page