(data stored in ACNUC7421 zone)

EMBL: CP002116.PE92

CP002116.PE92        Location/Qualifiers
FT   CDS             complement(96869..97747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0092"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119; KEGG: cbc:CbuK_1387 bacterial
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein; SPTR: Bacterial DNA-binding protein;
FT                   PFAM: Bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79252"
FT                   /db_xref="GOA:E1R8A8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A8"
FT                   /protein_id="ADK79252.1"
FT                   /translation="MNNDKQVVETMPKVIEQHLKGLAATLDFVDAEEGFSRLKQAWSEK
FT                   ERLFTGQTRLLEMAEIKELAEDDSRGCILLTNSGSLLSLFPHTGEGRAMEYASIPIRSD
FT                   VPDIIREQDVTYAPSLSVGNPAILHGAPIKKTSPVYRIAVCEEGVSPAEQAKRIREATI
FT                   FLTNGFARINRTIETPMAGKIEHFTKDRMAAYIAGRNDLTQLQVRRILDDFFSVVESGI
FT                   MLGERVSLGSLGKIGYRVRPPSKARIITVPATGEEMTIPAKPSRAVVKFSPSGRLKERA
FT                   EAIPIEEETDD"
     MNNDKQVVET MPKVIEQHLK GLAATLDFVD AEEGFSRLKQ AWSEKERLFT GQTRLLEMAE        60
     IKELAEDDSR GCILLTNSGS LLSLFPHTGE GRAMEYASIP IRSDVPDIIR EQDVTYAPSL       120
     SVGNPAILHG APIKKTSPVY RIAVCEEGVS PAEQAKRIRE ATIFLTNGFA RINRTIETPM       180
     AGKIEHFTKD RMAAYIAGRN DLTQLQVRRI LDDFFSVVES GIMLGERVSL GSLGKIGYRV       240
     RPPSKARIIT VPATGEEMTI PAKPSRAVVK FSPSGRLKER AEAIPIEEET DD               292
//

If you have problems or comments...

PBIL Back to PBIL home page