(data stored in ACNUC7421 zone)

EMBL: CP002116.PE93

CP002116.PE93        Location/Qualifiers
FT   CDS             97861..98385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctp:CTRG_05554 hypothetical protein; SPTR:
FT                   Whole genome shotgun sequence assembly, scaffold_14"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79253"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A9"
FT                   /protein_id="ADK79253.1"
FT                   /translation="MTDGNGIEGKIRDHLKLLVKTAGLPGNEDSLKQLENAWMEKMEAF
FT                   DSEVESRGMEVVDSFFADDERGALLMTYSGSLITLGPMVGAARSAAYRSIGIRNDVPES
FT                   IDSDAASLSGDVEVDSVVSFIDGPIEKSSPIFKIAVVSSDMAEEEQEELLAEATRILTE
FT                   SFVDVNKTIIQ"
     MTDGNGIEGK IRDHLKLLVK TAGLPGNEDS LKQLENAWME KMEAFDSEVE SRGMEVVDSF        60
     FADDERGALL MTYSGSLITL GPMVGAARSA AYRSIGIRND VPESIDSDAA SLSGDVEVDS       120
     VVSFIDGPIE KSSPIFKIAV VSSDMAEEEQ EELLAEATRI LTESFVDVNK TIIQ             174
//

If you have problems or comments...

PBIL Back to PBIL home page