(data stored in ACNUC7421 zone)

EMBL: CP002116.PE94

CP002116.PE94        Location/Qualifiers
FT   CDS             98389..99417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0094"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006186; KEGG: app:CAP2UW1_3783
FT                   metallophosphoesterase; SPTR: Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79254"
FT                   /db_xref="GOA:E1R8B0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B0"
FT                   /protein_id="ADK79254.1"
FT                   /translation="MFFLPSIVTRRTLPPREAYLHIVKAATDKLKGEDQLVRPRDEHNR
FT                   PGGLIRLQEGITMIVPDLHARIPFLLHALVFPVEGRPFIDLMKEGSGTMVCVGDGLHSE
FT                   ARGYQRWQVALQELLEGFFRHEAMDEEMLEGLGQMELVMRLKLAFPDRFHFLKGNHENI
FT                   LNREGNGDHPFRKFVLEGEMVRVYLQKFYGDDFLKSYADFERALPLVAADGNFMVSHAE
FT                   PARSFSREEVIRYRSLDDVVEGLTWTPNDGSEEGSVQTMIESFCASPDQAVYFGGHRTI
FT                   EGRYSLRASGRFIQLHNPVSFQVALADSGRPFDPERDIVDVSGDPAALLERSELEISEE
FT                   TP"
     MFFLPSIVTR RTLPPREAYL HIVKAATDKL KGEDQLVRPR DEHNRPGGLI RLQEGITMIV        60
     PDLHARIPFL LHALVFPVEG RPFIDLMKEG SGTMVCVGDG LHSEARGYQR WQVALQELLE       120
     GFFRHEAMDE EMLEGLGQME LVMRLKLAFP DRFHFLKGNH ENILNREGNG DHPFRKFVLE       180
     GEMVRVYLQK FYGDDFLKSY ADFERALPLV AADGNFMVSH AEPARSFSRE EVIRYRSLDD       240
     VVEGLTWTPN DGSEEGSVQT MIESFCASPD QAVYFGGHRT IEGRYSLRAS GRFIQLHNPV       300
     SFQVALADSG RPFDPERDIV DVSGDPAALL ERSELEISEE TP                          342
//

If you have problems or comments...

PBIL Back to PBIL home page