(data stored in ACNUC7421 zone)

EMBL: CP002116.PE95

CP002116.PE95        Location/Qualifiers
FT   CDS             99414..101030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0095"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR020635:IPR002290:IPR017442:IPR000719:IPR 008271;
FT                   KEGG: mxa:MXAN_6317 serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: Serine/threonine protein
FT                   kinase PksC; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79255"
FT                   /db_xref="GOA:E1R8B1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B1"
FT                   /protein_id="ADK79255.1"
FT                   /translation="MNRPPEMIGKYKIIDLIATGGMGAVYKGVHPTLDCYVIIKKLTLR
FT                   GNPDFAERFRREAKILMDFRNDNIVDIYDHFKEGRSHYIVLEYIDGLSLEQLIRRERYL
FT                   SNDMALYIFREVCKALDYAHKRRVVHRDIKPANILISKKGEVKLVDFGIASSKEEDGEA
FT                   GLTRDGMTLGSPSYMAPEQFENSRNVDQRADIYSLGVMLYESVTGKKPYPGGYTADLIA
FT                   AITKGKHPAPRRLNPKVNRFVSSIVKKTMHPKPRRRYQNLTSLLRRLDRYFHRKPVEAL
FT                   KEQLKKAISGGTLESTPRKKLGKLRRFFSIALPVFFLLFLLLGSAYRSGWYQRLFLADS
FT                   YGELRIALHLDHSYKEPKDLYLRGWLFADTGEDGTALDIDPIHFRLLPSEEREGDLNFV
FT                   SRRVFLPSGDYRLKVQIENNLFWNTFRLHTIKEQHNLYQGEQGRTITLCTSSHTLPLSV
FT                   DFFVQDCDTWVDITPISLIELKTGGRWTPWSDELAEGLTTGSVYRFRISAPGYTEKEFS
FT                   LLIREDQSTLYLNPRLEKSKL"
     MNRPPEMIGK YKIIDLIATG GMGAVYKGVH PTLDCYVIIK KLTLRGNPDF AERFRREAKI        60
     LMDFRNDNIV DIYDHFKEGR SHYIVLEYID GLSLEQLIRR ERYLSNDMAL YIFREVCKAL       120
     DYAHKRRVVH RDIKPANILI SKKGEVKLVD FGIASSKEED GEAGLTRDGM TLGSPSYMAP       180
     EQFENSRNVD QRADIYSLGV MLYESVTGKK PYPGGYTADL IAAITKGKHP APRRLNPKVN       240
     RFVSSIVKKT MHPKPRRRYQ NLTSLLRRLD RYFHRKPVEA LKEQLKKAIS GGTLESTPRK       300
     KLGKLRRFFS IALPVFFLLF LLLGSAYRSG WYQRLFLADS YGELRIALHL DHSYKEPKDL       360
     YLRGWLFADT GEDGTALDID PIHFRLLPSE EREGDLNFVS RRVFLPSGDY RLKVQIENNL       420
     FWNTFRLHTI KEQHNLYQGE QGRTITLCTS SHTLPLSVDF FVQDCDTWVD ITPISLIELK       480
     TGGRWTPWSD ELAEGLTTGS VYRFRISAPG YTEKEFSLLI REDQSTLYLN PRLEKSKL         538
//

If you have problems or comments...

PBIL Back to PBIL home page