(data stored in ACNUC7421 zone)

EMBL: CP002116.PE96

CP002116.PE96        Location/Qualifiers
FT   CDS             101044..101919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0096"
FT                   /product="FHA domain containing protein"
FT                   /note="InterPro IPR000253; KEGG: rrs:RoseRS_3946
FT                   hypothetical protein; PFAM: Forkhead-associated protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79256"
FT                   /db_xref="GOA:E1R8B2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B2"
FT                   /protein_id="ADK79256.1"
FT                   /translation="MSIGLKRIIIIALGILAGAAAWPLMELVLSFQSLFPGYFIFSIVQ
FT                   GALFGLVLGLFFGSGEGLTSRNGKKLGHGLASGAAVGVIGGVVGFLFGQGVLFFILDKT
FT                   SNYLAVPVARGIGWALLGLFVGAVDGIRVRSLRKTAIGALGGIIGGAAGGAAIELIRLH
FT                   FSELLMIRAVGFILFGLLVGIGYAVAERSFSFGILHVLNGPQRGREYSLSQSSFFVGTS
FT                   SSNDISAEGYHDIEPRHIRFYSKRKELYIKDISGKAGTKVNEEPLRGERLLKYEDVIQV
FT                   GSLKICYLTE"
     MSIGLKRIII IALGILAGAA AWPLMELVLS FQSLFPGYFI FSIVQGALFG LVLGLFFGSG        60
     EGLTSRNGKK LGHGLASGAA VGVIGGVVGF LFGQGVLFFI LDKTSNYLAV PVARGIGWAL       120
     LGLFVGAVDG IRVRSLRKTA IGALGGIIGG AAGGAAIELI RLHFSELLMI RAVGFILFGL       180
     LVGIGYAVAE RSFSFGILHV LNGPQRGREY SLSQSSFFVG TSSSNDISAE GYHDIEPRHI       240
     RFYSKRKELY IKDISGKAGT KVNEEPLRGE RLLKYEDVIQ VGSLKICYLT E                291
//

If you have problems or comments...

PBIL Back to PBIL home page