(data stored in ACNUC7421 zone)

EMBL: CP002116.PE98

CP002116.PE98        Location/Qualifiers
FT   CDS             complement(103360..104226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0098"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: gau:GAU_0613 hypothetical
FT                   membrane protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Hypothetical membrane protein; PFAM:
FT                   EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79258"
FT                   /db_xref="GOA:E1R8B4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B4"
FT                   /protein_id="ADK79258.1"
FT                   /translation="MTHLMLIAAAFIWGINPMIMKIGLATIDPLRYNTLRLLLAFLVSL
FT                   IFVLLGRRWKPVAKEDRKRFIAVGLGGFFIFQGGYTFGVHDTAASISAIILALLPVFVA
FT                   VISIVTRQEKITVKKALGIALSVLGVLAITAGGEAVSVKGTYLRGVLLLVIAEFAYAVY
FT                   TVYVRPLTKRYSIEQIVCIVIFIVLLPFLLISLPVFLRSGLFFPTLAESFSIGYAGTFG
FT                   ILIGNVLWSHGVKRIGSTGTSMYSNLSPIFGVIAGFLVLAERLAPLQIAGGAAVLLGVW
FT                   VVNRKKA"
     MTHLMLIAAA FIWGINPMIM KIGLATIDPL RYNTLRLLLA FLVSLIFVLL GRRWKPVAKE        60
     DRKRFIAVGL GGFFIFQGGY TFGVHDTAAS ISAIILALLP VFVAVISIVT RQEKITVKKA       120
     LGIALSVLGV LAITAGGEAV SVKGTYLRGV LLLVIAEFAY AVYTVYVRPL TKRYSIEQIV       180
     CIVIFIVLLP FLLISLPVFL RSGLFFPTLA ESFSIGYAGT FGILIGNVLW SHGVKRIGST       240
     GTSMYSNLSP IFGVIAGFLV LAERLAPLQI AGGAAVLLGV WVVNRKKA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page