(data stored in ACNUC7421 zone)

EMBL: CP002116.PE99

CP002116.PE99        Location/Qualifiers
FT   CDS             complement(104240..105202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0099"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR020084; KEGG: dat:HRM2_01950
FT                   MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX hydrolase;
FT                   SPTR: MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79259"
FT                   /db_xref="GOA:E1R8B5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B5"
FT                   /protein_id="ADK79259.1"
FT                   /translation="MLAEKLSTPIYYLMLSIMILNLFQRKHMATGEKKRFATLWLAGTL
FT                   LILQIEIGLLAANKQPDWMLIPAFALYAVILFLLRKKIFVFRRTCASCGAPLASREFIG
FT                   RDDNLCANCAPTPEGEEKPEEEKEEKPQPITIAPPEIDEENRHTLGKGTPREEIPRDTD
FT                   GIDWDAWEFAEKAVLCYLFRGDEVLLIHKKTGLGRGLVNAPGGRIEAAEMPMDAAIREM
FT                   QEETGITPKELKEVASLHFIFTDGYSLKGTVFFAYDHEGEARATDEADPFWTPVGEIPF
FT                   DKMWEDDALWLPKVLEGKRVSGYFIFEDEAMVSQKIIES"
     MLAEKLSTPI YYLMLSIMIL NLFQRKHMAT GEKKRFATLW LAGTLLILQI EIGLLAANKQ        60
     PDWMLIPAFA LYAVILFLLR KKIFVFRRTC ASCGAPLASR EFIGRDDNLC ANCAPTPEGE       120
     EKPEEEKEEK PQPITIAPPE IDEENRHTLG KGTPREEIPR DTDGIDWDAW EFAEKAVLCY       180
     LFRGDEVLLI HKKTGLGRGL VNAPGGRIEA AEMPMDAAIR EMQEETGITP KELKEVASLH       240
     FIFTDGYSLK GTVFFAYDHE GEARATDEAD PFWTPVGEIP FDKMWEDDAL WLPKVLEGKR       300
     VSGYFIFEDE AMVSQKIIES                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page