(data stored in ACNUC7421 zone)

EMBL: CP002157.PE10

CP002157.PE10        Location/Qualifiers
FT   CDS             complement(25269..29078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16181"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16181"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00639"
FT                   /db_xref="GOA:A4AT69"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT69"
FT                   /protein_id="EAR00639.1"
FT                   /translation="MFTNQTERINFASAKNTPEYPDFLDIQIKSFQDFFQLETKSDQRG
FT                   TEGLYNTFMENFPITDTRNQFVLEFLDYFIDPPRYSIQECIERGLTYSVPLKARLKLYC
FT                   TDPEHEDFETIVQDVYLGTIPYMTPSGTFVINGAERVVVSQLHRSPGVFFGQSFHANGT
FT                   KLYSARVIPFKGSWIEFATDINGVMYAYIDRKKKLPVTTLFRAIGFESDKDILEIFDLS
FT                   EEVKVSKAGLKKVLGRKLAARVLNTWHEDFVDEDTGEVVSIERNEIILDRDTVLEKDHI
FT                   EEILGTDVKTILLHKENNAQSDYAIIHNTLQKDPTNSEKEAVEHIYRQLRNAEPPDEET
FT                   ARGIIDKLFFSDQRYNLGEVGRYRMNKKLQLDIGMDKQVLTKEDIITIIKYLIELINSK
FT                   AEIDDIDHLSNRRVRTVGEQLSSQFGVGLARMARTIRERMNVRDNEVFTPIDLINAKTL
FT                   SSVINSFFGTNQLSQFMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGR
FT                   LCPIETPEGPNIGLISSLAVFAKVNPMGFLETPYRKVDGAKVDTKEYMYLSAEEEEGMK
FT                   IAQANIPLKDNGAIDSEKVIAREEGDFPVVDPKEVNYTDVAPNQIASISASLIPFLEHD
FT                   DANRALMGSNMMRQAVPLLKPQSPIVGTGLERQVASDSRVLINAEGDGTIEYVDSQKIT
FT                   IKYKRTDAERLISFDEDEKTYNLVKFRKTNQGTSINLKPIVKKGDKVKKGQVLCEGYAT
FT                   EKGELALGRNLTVAFMPWKGYNFEDAIVISEKVVREDIFTSIHVDEYALEVRDTKLGAE
FT                   ELTHDIPNVSEEATKDLDENGMIRIGAEVKPGDILIGKITPKGESDPTPEEKLLRAIFG
FT                   DKAGDVKDASLKASPSLRGVVIDKKLFSRSIKDKRKRSEDKEAISTLELEYEVKFQQLK
FT                   DVLVEKLFTLINGKTSQGVLNDLGEEVLPKGKKYTMKMLNSVDDFAHLVAGTWTTDKDV
FT                   NHSVADLLHNYKIKLNDLQGNLRRDKFTISVGDELPAGIMKLAKVYVAKKRKLKVGDKM
FT                   AGRHGNKGIVSRIVRQEDMPFLEDGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGLKLG
FT                   RKYATPIFDGATLDEINAYTDEAGIPRFGHTHLYDGGTGKRFDQAATVGVIYMLKLGHM
FT                   VDDKMHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGASATLREILTVKSDD
FT                   VIGRAKTYESIVKGETMPEPGLPESFNVLMHELKGLGLDIRLEE"
     MFTNQTERIN FASAKNTPEY PDFLDIQIKS FQDFFQLETK SDQRGTEGLY NTFMENFPIT        60
     DTRNQFVLEF LDYFIDPPRY SIQECIERGL TYSVPLKARL KLYCTDPEHE DFETIVQDVY       120
     LGTIPYMTPS GTFVINGAER VVVSQLHRSP GVFFGQSFHA NGTKLYSARV IPFKGSWIEF       180
     ATDINGVMYA YIDRKKKLPV TTLFRAIGFE SDKDILEIFD LSEEVKVSKA GLKKVLGRKL       240
     AARVLNTWHE DFVDEDTGEV VSIERNEIIL DRDTVLEKDH IEEILGTDVK TILLHKENNA       300
     QSDYAIIHNT LQKDPTNSEK EAVEHIYRQL RNAEPPDEET ARGIIDKLFF SDQRYNLGEV       360
     GRYRMNKKLQ LDIGMDKQVL TKEDIITIIK YLIELINSKA EIDDIDHLSN RRVRTVGEQL       420
     SSQFGVGLAR MARTIRERMN VRDNEVFTPI DLINAKTLSS VINSFFGTNQ LSQFMDQTNP       480
     LAEITHKRRL SALGPGGLSR ERAGFEVRDV HYTHYGRLCP IETPEGPNIG LISSLAVFAK       540
     VNPMGFLETP YRKVDGAKVD TKEYMYLSAE EEEGMKIAQA NIPLKDNGAI DSEKVIAREE       600
     GDFPVVDPKE VNYTDVAPNQ IASISASLIP FLEHDDANRA LMGSNMMRQA VPLLKPQSPI       660
     VGTGLERQVA SDSRVLINAE GDGTIEYVDS QKITIKYKRT DAERLISFDE DEKTYNLVKF       720
     RKTNQGTSIN LKPIVKKGDK VKKGQVLCEG YATEKGELAL GRNLTVAFMP WKGYNFEDAI       780
     VISEKVVRED IFTSIHVDEY ALEVRDTKLG AEELTHDIPN VSEEATKDLD ENGMIRIGAE       840
     VKPGDILIGK ITPKGESDPT PEEKLLRAIF GDKAGDVKDA SLKASPSLRG VVIDKKLFSR       900
     SIKDKRKRSE DKEAISTLEL EYEVKFQQLK DVLVEKLFTL INGKTSQGVL NDLGEEVLPK       960
     GKKYTMKMLN SVDDFAHLVA GTWTTDKDVN HSVADLLHNY KIKLNDLQGN LRRDKFTISV      1020
     GDELPAGIMK LAKVYVAKKR KLKVGDKMAG RHGNKGIVSR IVRQEDMPFL EDGTPVDIVL      1080
     NPLGVPSRMN IGQIYETVLG WAGLKLGRKY ATPIFDGATL DEINAYTDEA GIPRFGHTHL      1140
     YDGGTGKRFD QAATVGVIYM LKLGHMVDDK MHARSIGPYS LITQQPLGGK AQFGGQRFGE      1200
     MEVWALEAYG ASATLREILT VKSDDVIGRA KTYESIVKGE TMPEPGLPES FNVLMHELKG      1260
     LGLDIRLEE                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page