(data stored in ACNUC7421 zone)

EMBL: CP002157.PE103

CP002157.PE103       Location/Qualifiers
FT   CDS             122842..123879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16646"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00732"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG2"
FT                   /protein_id="EAR00732.1"
FT                   /translation="MGFHSDFINDAGFDKNLGLVGFYHDATNLLVSGTSSPVFYDFEMA
FT                   IENNLYIDVSIGIDNSLNFIYGNIISSRDKKNVYVKLSENAIYDGEMNLSKIDGHVAVE
FT                   NQKEFSFPVGYDDILRPLTIKFIDETFFAKCEYYHESADLPSSYSTGQDFTKKDITLGS
FT                   IHPEEFWKLGTSGMVQVSLNWKEESNLSTSTKKIDNVMVTAWNKKDEQWDNLGNSKFEG
FT                   NLDEGVVTSNVFNANNYEVFTLGFLFDIETNKPGNYALTPNGDGVNDYFALDIIERSPD
FT                   NELKIFNRSGRLVYEKTNYKNEFHGIANKNTNKINQKLPKGVYYYIIELKDLNLKHQGY
FT                   FYLSL"
     MGFHSDFIND AGFDKNLGLV GFYHDATNLL VSGTSSPVFY DFEMAIENNL YIDVSIGIDN        60
     SLNFIYGNII SSRDKKNVYV KLSENAIYDG EMNLSKIDGH VAVENQKEFS FPVGYDDILR       120
     PLTIKFIDET FFAKCEYYHE SADLPSSYST GQDFTKKDIT LGSIHPEEFW KLGTSGMVQV       180
     SLNWKEESNL STSTKKIDNV MVTAWNKKDE QWDNLGNSKF EGNLDEGVVT SNVFNANNYE       240
     VFTLGFLFDI ETNKPGNYAL TPNGDGVNDY FALDIIERSP DNELKIFNRS GRLVYEKTNY       300
     KNEFHGIANK NTNKINQKLP KGVYYYIIEL KDLNLKHQGY FYLSL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page