(data stored in ACNUC7421 zone)

EMBL: CP002157.PE104

CP002157.PE104       Location/Qualifiers
FT   CDS             124253..124987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16651"
FT                   /product="D-alanyl-D-alanine carboxypeptidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16651"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00733"
FT                   /db_xref="GOA:A4ATG3"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG3"
FT                   /protein_id="EAR00733.1"
FT                   /translation="MKRRSFIKKSSISGLALTMVPSFVFPNENEYSVLELMGKEDIQLY
FT                   GEGINLRKEAHDAFLKMKKAAYSDGIDLKIVSSYRNYYRQEGIWERKYMRYTEDDGMTP
FT                   LKAIDKIIEYSTIPGTSRHHWGTDIDIIDGYRKTTGDVLVPEKFESEGPFVDLKKWMDE
FT                   NCNSFGYYLVYTNEPKRRGFKYEPWHYSYAPISIPMLTAYRRLNILQLLRQEELYGSEH
FT                   FTTGFIKNYIQNNILDINPELL"
     MKRRSFIKKS SISGLALTMV PSFVFPNENE YSVLELMGKE DIQLYGEGIN LRKEAHDAFL        60
     KMKKAAYSDG IDLKIVSSYR NYYRQEGIWE RKYMRYTEDD GMTPLKAIDK IIEYSTIPGT       120
     SRHHWGTDID IIDGYRKTTG DVLVPEKFES EGPFVDLKKW MDENCNSFGY YLVYTNEPKR       180
     RGFKYEPWHY SYAPISIPML TAYRRLNILQ LLRQEELYGS EHFTTGFIKN YIQNNILDIN       240
     PELL                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page