(data stored in ACNUC7421 zone)

EMBL: CP002157.PE113

CP002157.PE113       Location/Qualifiers
FT   CDS             complement(131461..132768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16696"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16696"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00742"
FT                   /db_xref="GOA:A4ATH2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH2"
FT                   /protein_id="EAR00742.1"
FT                   /translation="MILATSTGGTILITVISFLILLLALVALLLFTKEKLSPSGPVTIT
FT                   INGEKKVEVSSGGSLLSTLGNQKIFLPSACGGGGTCIQCECHVLEGGGEALPTETPHFS
FT                   KRELNEGARLACQVKVKQDMNITIPEEVFGIKKWEGTVVRNYNVASFIKEFVVEIPEDM
FT                   GYKAGGYIQIEIPPCEIKYSDIDITAHPEEHETPDKFQAEWDKFNLWPLVMKNPETVER
FT                   AYSMASFPAEGREIMLNVRIATPPWDRSKNGWMDVNPGVASSYIFAQKPGDKVVISGPY
FT                   GEFFINESESEMLYVGGGAGMAPMRSHLYHLFKTLRTNRKVTYWYGGRSKRELFYLDHF
FT                   YQLEKEFSNFKFYLALSEPMEEDNWKVKEDIDAPGDGFVGFIHNCVIDNYLSKHESPED
FT                   IELYFCGPPLMNKAVQKMGEDFGIPDEHIRFDDFGG"
     MILATSTGGT ILITVISFLI LLLALVALLL FTKEKLSPSG PVTITINGEK KVEVSSGGSL        60
     LSTLGNQKIF LPSACGGGGT CIQCECHVLE GGGEALPTET PHFSKRELNE GARLACQVKV       120
     KQDMNITIPE EVFGIKKWEG TVVRNYNVAS FIKEFVVEIP EDMGYKAGGY IQIEIPPCEI       180
     KYSDIDITAH PEEHETPDKF QAEWDKFNLW PLVMKNPETV ERAYSMASFP AEGREIMLNV       240
     RIATPPWDRS KNGWMDVNPG VASSYIFAQK PGDKVVISGP YGEFFINESE SEMLYVGGGA       300
     GMAPMRSHLY HLFKTLRTNR KVTYWYGGRS KRELFYLDHF YQLEKEFSNF KFYLALSEPM       360
     EEDNWKVKED IDAPGDGFVG FIHNCVIDNY LSKHESPEDI ELYFCGPPLM NKAVQKMGED       420
     FGIPDEHIRF DDFGG                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page