(data stored in ACNUC7421 zone)

EMBL: CP002157.PE114

CP002157.PE114       Location/Qualifiers
FT   CDS             complement(132771..133517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16701"
FT                   /product="NADH:ubiquinone oxidoreductase, Na translocating,
FT                   E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16701"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00743"
FT                   /db_xref="GOA:A4ATH3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH3"
FT                   /protein_id="EAR00743.1"
FT                   /translation="MLEHIELFFRSIFIDNMVFAVFLGMCSYLAVSKKVATAVGLGAAV
FT                   IFVLAVTVPLNWLLDQYLLRDGALAWLGPEYADYNLSFLSFILFIATIATMVQLVEIVV
FT                   EKFSPSLYNSLGIFLPLIAVNCAILGGSLFMQSREIASLGLAFNYGVSSGIGWFLAILA
FT                   IAAIREKIRYSNVPAPLRGLGITFIITGLMGIGFQSFGGMLTGGGEEAAPVKEKTTAEK
FT                   LEKVDKKENNKEIDEKEISYNDAINK"
     MLEHIELFFR SIFIDNMVFA VFLGMCSYLA VSKKVATAVG LGAAVIFVLA VTVPLNWLLD        60
     QYLLRDGALA WLGPEYADYN LSFLSFILFI ATIATMVQLV EIVVEKFSPS LYNSLGIFLP       120
     LIAVNCAILG GSLFMQSREI ASLGLAFNYG VSSGIGWFLA ILAIAAIREK IRYSNVPAPL       180
     RGLGITFIIT GLMGIGFQSF GGMLTGGGEE AAPVKEKTTA EKLEKVDKKE NNKEIDEKEI       240
     SYNDAINK                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page