(data stored in ACNUC7421 zone)

EMBL: CP002157.PE119

CP002157.PE119       Location/Qualifiers
FT   CDS             137744..138964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16726"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00748"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031345"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH8"
FT                   /protein_id="EAR00748.1"
FT                   /translation="MFLLFASTGLSQVQEEVNPPEHIKSVIFKGEKEDQFPIVEIGEPI
FT                   FLEFDDLLANEQDYYYKIVHCDYDWSPSRLLKSQYLSGIDNQRILDYENSYSTLQSYSN
FT                   YKLTIPNSNVRLKVSGNYLLEIYNSSYELQFSRKFVVYKDLVKVGGIIKRSRDFEYLNE
FT                   KQVVQFNINAGNFRLVNPKKEVKVALLQNYHWPTAVFNIKPQFTLGSELVYKYDKETSF
FT                   FGGNEYLNFDTKDLRAPSSAISHIEIGELYNHYLFSNRIRANRPYTYFPDINGDFVVRT
FT                   LQGTDVSREAEYTNVHFSLPYSDAIGLDDVYVYGKHNNYAFTNENKMIYNEKNGMMEGT
FT                   VKMKQGFYNYKYVIQRGSEQIDLNTISGNFHFTENTYTILVYYRNFGDLYDSIIGVGSA
FT                   NSQNISN"
     MFLLFASTGL SQVQEEVNPP EHIKSVIFKG EKEDQFPIVE IGEPIFLEFD DLLANEQDYY        60
     YKIVHCDYDW SPSRLLKSQY LSGIDNQRIL DYENSYSTLQ SYSNYKLTIP NSNVRLKVSG       120
     NYLLEIYNSS YELQFSRKFV VYKDLVKVGG IIKRSRDFEY LNEKQVVQFN INAGNFRLVN       180
     PKKEVKVALL QNYHWPTAVF NIKPQFTLGS ELVYKYDKET SFFGGNEYLN FDTKDLRAPS       240
     SAISHIEIGE LYNHYLFSNR IRANRPYTYF PDINGDFVVR TLQGTDVSRE AEYTNVHFSL       300
     PYSDAIGLDD VYVYGKHNNY AFTNENKMIY NEKNGMMEGT VKMKQGFYNY KYVIQRGSEQ       360
     IDLNTISGNF HFTENTYTIL VYYRNFGDLY DSIIGVGSAN SQNISN                      406
//

If you have problems or comments...

PBIL Back to PBIL home page