(data stored in ACNUC7421 zone)

EMBL: CP002157.PE123

CP002157.PE123       Location/Qualifiers
FT   CDS             complement(142604..143269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16746"
FT                   /product="glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16746"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00752"
FT                   /db_xref="GOA:A4ATI2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI2"
FT                   /protein_id="EAR00752.1"
FT                   /translation="MLFLPNTKVRMKAELVFKYFPNLSEAQKTQFIRLEELYKDWNLKI
FT                   NVVSRKDIDELYLRHVLHSLGIAKIQEFKPGASILDVGTGGGFPGIPLAILFPEADFTL
FT                   VDSIGKKVKVVQEVVEGLGIENVTSINSRVEEVNGRYDFIVSRAVAAMPTFVHWVKGKI
FT                   KKESVHDRRNGILYLKGGDLSEELKDYKNAQTYDLPAYFTEDFFETKKVVYLPLKYKG"
     MLFLPNTKVR MKAELVFKYF PNLSEAQKTQ FIRLEELYKD WNLKINVVSR KDIDELYLRH        60
     VLHSLGIAKI QEFKPGASIL DVGTGGGFPG IPLAILFPEA DFTLVDSIGK KVKVVQEVVE       120
     GLGIENVTSI NSRVEEVNGR YDFIVSRAVA AMPTFVHWVK GKIKKESVHD RRNGILYLKG       180
     GDLSEELKDY KNAQTYDLPA YFTEDFFETK KVVYLPLKYK G                           221
//

If you have problems or comments...

PBIL Back to PBIL home page