(data stored in ACNUC7421 zone)

EMBL: CP002157.PE126

CP002157.PE126       Location/Qualifiers
FT   CDS             complement(145717..147207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16761"
FT                   /product="putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16761"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00755"
FT                   /db_xref="GOA:A4ATI5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI5"
FT                   /protein_id="EAR00755.1"
FT                   /translation="MDLNSKIIFHLMGLLLLFNGLFMLIAAVVSGVYDDGATLDITIAS
FT                   ITSMFIGLSSMYFTREHKKEVKRKEGYIIVAFGWIIMSLSGMLPYLFSGAIPNVTNAFF
FT                   ETISGYTTTGATILDDIESLPEGILLWRSLTHWIGGMGIIVLAIAILPLLGIGGMQLFA
FT                   AEAPGPSADKLHPRITDTAKRLWYIYVGYTIAETLLLKLAGMSFFDAVNHSLATLSTGG
FT                   FSTKNASLAYWNDQPLIQYIVIFFMFLAGSNFVLSYFAFKGKVQKVIKDEEFKFYLGFV
FT                   VLFTVVVALVIYFDANVPVSDYHPMVNGAEESSFRHALFQVVAVVTTTGFVTADFSSWT
FT                   PFLTVFFFGLFFLGGSAGSTAGGIKVMRHLLIIKNGLLEFKRTLHTNAVIPVRYNNKTV
FT                   KEHIVYNIIAFFVLYMLSFIIGSMVLSFLGLDFESAIGGAASSLGNVGPALGSLNPLSN
FT                   FNDIPMLGKWWCGFLMLLGRLELFTVLIILTPYFWKDI"
     MDLNSKIIFH LMGLLLLFNG LFMLIAAVVS GVYDDGATLD ITIASITSMF IGLSSMYFTR        60
     EHKKEVKRKE GYIIVAFGWI IMSLSGMLPY LFSGAIPNVT NAFFETISGY TTTGATILDD       120
     IESLPEGILL WRSLTHWIGG MGIIVLAIAI LPLLGIGGMQ LFAAEAPGPS ADKLHPRITD       180
     TAKRLWYIYV GYTIAETLLL KLAGMSFFDA VNHSLATLST GGFSTKNASL AYWNDQPLIQ       240
     YIVIFFMFLA GSNFVLSYFA FKGKVQKVIK DEEFKFYLGF VVLFTVVVAL VIYFDANVPV       300
     SDYHPMVNGA EESSFRHALF QVVAVVTTTG FVTADFSSWT PFLTVFFFGL FFLGGSAGST       360
     AGGIKVMRHL LIIKNGLLEF KRTLHTNAVI PVRYNNKTVK EHIVYNIIAF FVLYMLSFII       420
     GSMVLSFLGL DFESAIGGAA SSLGNVGPAL GSLNPLSNFN DIPMLGKWWC GFLMLLGRLE       480
     LFTVLIILTP YFWKDI                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page